DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and CG34353

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:373 Identity:84/373 - (22%)
Similarity:131/373 - (35%) Gaps:116/373 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 SSSQSQSPSPPAASA-SASSPSSFSSFAVAHGPQTEATNHTFKSLAFLDASFGSDLFAQTDAKRE 217
            :|.|:......||.| :.|.|.......|...|..     .|.::|.:...|.|........|.|
  Fly    26 NSKQNSKTGKMAAEARTISKPGHIRDRRVGSLPHI-----LFLAIAVVSLHFESVSAQSMMTKNE 85

  Fly   218 RSGAADEESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTV 282
            ....:..|:           |.|     |||.|    .::.|.|.:.....|:|  ||.:.|||.
  Fly    86 PMFISRSET-----------FKF-----ITGET----IVLPCEVANTDTYVVAW--KRGIAILTA 128

  Fly   283 GTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNT-EPKMSMAFQLNIIEISPDAKA 346
            |:...|.|.|.::...     :.|.::..|..|:|.|.||:.| :|:          ||:...:.
  Fly   129 GSVKVTPDPRVRLVNG-----FNLQIRDALPTDAGDYICQIATMDPR----------EITHTVEI 178

  Fly   347 VISGPPDLH---------FKAGSAIILNCLV---QQPSVKDIGPIYWYR-------GE-----HM 387
            ::  ||.:|         .|.||::.:.|..   ..|:|.      |.|       ||     |:
  Fly   179 LV--PPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVT------WSRKNNILPNGEEKLHSHV 235

  Fly   388 ITPFDADD--------------GQ-------------PEIPAGR-----GEHPQG-----IPEDT 415
            ::..:.|.              ||             |||...|     ||..:.     :..:|
  Fly   236 LSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGET 300

  Fly   416 SPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTC 463
            .|..|..:..:|::...|..||:: |.  :..|.|......|.|||:|
  Fly   301 QPEVIWFKDTMQLDTTERHIMETR-GS--RHTLIIRKVHPQDFGNYSC 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 26/87 (30%)
IG_like 243..329 CDD:214653 26/86 (30%)
Ig 350..464 CDD:299845 38/175 (22%)
IG_like <441..477 CDD:214653 8/23 (35%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 26/100 (26%)
Ig 103..177 CDD:143165 24/90 (27%)
IG_like 191..269 CDD:214653 14/83 (17%)
IGc2 198..258 CDD:197706 11/65 (17%)
I-set 273..360 CDD:254352 21/76 (28%)
Ig 290..359 CDD:143165 15/59 (25%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.