DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and igsf9ba

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:369 Identity:71/369 - (19%)
Similarity:121/369 - (32%) Gaps:114/369 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HQQHQQQHRQDQQDQKDPRAAKQICNINLCGFLRRSGADDVDVIEPR--SP-------GHAADVD 71
            |.:.....|.:.|....||||:::          ..|...| |::|.  ||       .||...|
Zfish  1199 HSESSDGWRSEAQPWMSPRAARKM----------DLGLQQV-VLQPSRLSPLTQTPPSSHAGSPD 1252

  Fly    72 VAAAAAGATTSVAATAAAAAAATTRAAATTRAVIIIMALVVSIMQQQQQSLLWPFCNGLAAAAAS 136
            :........:.:.::.:.....:.|..|:           ||..::           .|:::.|:
Zfish  1253 ILVRPPPRPSILRSSRSQEMPESARHPAS-----------VSFSRR-----------SLSSSPAT 1295

  Fly   137 TGQPDDSGDGPTLS--------TFLSSSQSQSPSPPAASASASSPSSFSSFAVAHGPQTEATNHT 193
            :.....||..|:||        |..:|..||||||||.|                          
Zfish  1296 SPTQGQSGQRPSLSYRAHMAFATAAASYPSQSPSPPAES-------------------------- 1334

  Fly   194 FKSLAFLDASFGSDLFAQTDAKRERSGAADEESQDADTSQSLPIFDFGMPRNITGRTGHTEAII- 257
                        ||.|.|..::|.    .|||...::.|   |....|..|...|.... ||:| 
Zfish  1335 ------------SDAFGQMPSQRR----TDEEMLPSEPS---PGEHLGAVRVPAGSESF-EALIN 1379

  Fly   258 ----KCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGI 318
                |.:..|.:..:.|..:||          |..|..:.|...:..:.....|:.:|..|.   
Zfish  1380 YCINKAKKSSANKNNNSRFKKR----------TDMSTSQTQQPHASQASVQREHLSSPSKKK--- 1431

  Fly   319 YECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAI 362
            ::..:...|.:.::..|..:....|.|.:::....:....||.:
Zfish  1432 WKSTLRKHPCLHLSSLLRWLHPREDRKFLLASMDPVSSNYGSLL 1475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 17/91 (19%)
IG_like 243..329 CDD:214653 17/90 (19%)
Ig 350..464 CDD:299845 2/13 (15%)
IG_like <441..477 CDD:214653
igsf9baXP_009289969.2 IG 30..115 CDD:214652
I-set 139..225 CDD:254352
I-set 229..321 CDD:333254
Ig 345..415 CDD:325142
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285 48/239 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.