DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and nitr12

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001020667.1 Gene:nitr12 / 557932 ZFINID:ZDB-GENE-041001-1 Length:318 Species:Danio rerio


Alignment Length:265 Identity:57/265 - (21%)
Similarity:93/265 - (35%) Gaps:85/265 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 RTGHTEAII----------------KCRVDSLHDKSVSWIRKRDLHILTVGTA------------ 285
            |||.:.|::                :|.:....:...||.::      |:|.|            
Zfish    13 RTGFSGAVVQKKVLESFTAGQTVTLECLISVNLENYFSWFKQ------TLGEAPTCIVSLYAESS 71

  Fly   286 ------TYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEP--KMSMAFQLNIIEISP 342
                  .:.::.|..|.:.|::  :.|::|.....|:|||.|......  ..|....||..:.|.
Zfish    72 TPVFYGEFKNNHRMSVQKEKNT--FVLNIKEAKPSDAGIYYCGARDYDLITFSNGLFLNYKDAST 134

  Fly   343 ---DAKAVISGP-------PDLHFKAGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQ 397
               ..|..:|||       |:  |..|.::.|:|.|.....::...|||:|.|.    .||    
Zfish   135 KQHHIKQFLSGPNLGTEHEPE--FNPGDSVNLHCSVLTERCEENHTIYWFRHEF----GDA---- 189

  Fly   398 PEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYT 462
                     ||..|.:|.:..|       |.|..:...::|.:.:..|..|.:     ||.|.|.
Zfish   190 ---------HPGLIYKDGNTTD-------QCEKRSEKDVQSCIYNLPKKNLNL-----TDAGVYY 233

  Fly   463 CQPTT 467
            |...|
Zfish   234 CAVAT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 20/116 (17%)
IG_like 243..329 CDD:214653 20/115 (17%)
Ig 350..464 CDD:299845 29/120 (24%)
IG_like <441..477 CDD:214653 8/27 (30%)
nitr12NP_001020667.1 IgV 28..124 CDD:143167 17/103 (17%)
IG_like 30..123 CDD:214653 16/100 (16%)
V-set 150..253 CDD:284989 29/120 (24%)
IG_like 155..236 CDD:214653 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.