Sequence 1: | NP_001014459.2 | Gene: | dpr3 / 3346208 | FlyBaseID: | FBgn0053516 | Length: | 522 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020667.1 | Gene: | nitr12 / 557932 | ZFINID: | ZDB-GENE-041001-1 | Length: | 318 | Species: | Danio rerio |
Alignment Length: | 265 | Identity: | 57/265 - (21%) |
---|---|---|---|
Similarity: | 93/265 - (35%) | Gaps: | 85/265 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 249 RTGHTEAII----------------KCRVDSLHDKSVSWIRKRDLHILTVGTA------------ 285
Fly 286 ------TYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEP--KMSMAFQLNIIEISP 342
Fly 343 ---DAKAVISGP-------PDLHFKAGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQ 397
Fly 398 PEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYT 462
Fly 463 CQPTT 467 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr3 | NP_001014459.2 | Ig | 243..330 | CDD:299845 | 20/116 (17%) |
IG_like | 243..329 | CDD:214653 | 20/115 (17%) | ||
Ig | 350..464 | CDD:299845 | 29/120 (24%) | ||
IG_like | <441..477 | CDD:214653 | 8/27 (30%) | ||
nitr12 | NP_001020667.1 | IgV | 28..124 | CDD:143167 | 17/103 (17%) |
IG_like | 30..123 | CDD:214653 | 16/100 (16%) | ||
V-set | 150..253 | CDD:284989 | 29/120 (24%) | ||
IG_like | 155..236 | CDD:214653 | 27/111 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1457433at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |