DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:207 Identity:44/207 - (21%)
Similarity:75/207 - (36%) Gaps:62/207 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 RFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHF 356
            |::|..|.|:.::.|.:......|...||||.......|...:|.::....|.:  |.|.|.:..
Human    71 RYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTV
LIPPEDTR--IDGGPVILL 133

  Fly   357 KAGSAIILNCLVQQPSVKDIGPIYWYR------------------------GEHMITPFDADDGQ 397
            :||:...|.|  :..:.|....|.|:|                        .:.:|.|.|.|.|:
Human   134 QAGTPHNLTC--RAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGR 196

  Fly   398 --------PEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQ 454
                    ..||:|:         :||     .|:|:.......:::|.|   |::...|:.   
Human   197 VFTCRSMNEAIPSGK---------ETS-----IELDVHHPPTVTLSIEPQ---TVQEGERVV--- 241

  Fly   455 TTDTGNYTCQPT 466
                  :|||.|
Human   242 ------FTCQAT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 10/37 (27%)
IG_like 243..329 CDD:214653 10/36 (28%)
Ig 350..464 CDD:299845 27/145 (19%)
IG_like <441..477 CDD:214653 6/26 (23%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 12/44 (27%)
Ig 25..116 CDD:299845 12/44 (27%)
Ig2_KIRREL3-like 138..219 CDD:143236 17/96 (18%)
I-set 223..304 CDD:254352 8/37 (22%)
Ig_2 227..305 CDD:290606 8/33 (24%)
Ig_2 311..405 CDD:290606
IG_like 314..405 CDD:214653
Ig5_KIRREL3 407..504 CDD:143306
IG_like 416..504 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.