DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and iglon5

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:303 Identity:69/303 - (22%)
Similarity:120/303 - (39%) Gaps:98/303 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 DFG-MPRNITGRTGHTEAIIKCRVDS--LHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKD 300
            :|| :|.|||...|.: .:::|::|.  .|.   :|:.:.  :||..||..::.|.|..: |:.:
Zfish    28 EFGHLPDNITVLEGES-VVLRCKIDEEVTHK---AWLNRS--NILFTGTDKWSLDSRVSL-ENNN 85

  Fly   301 SREWTLHVKAPLAKDSGIYEC--QVNTEPKMSMAFQL-----NIIEISPDAKAVISGPPDLHFKA 358
            :.::::.::..:..|.|.|.|  |...:|:.:..:.:     .|:.||.| |:|         ..
Zfish    86 NSDFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQD-KSV---------NE 140

  Fly   359 GSAIILNCLV---QQPSV--KDIGPIYWYRGEHM-ITPFDADDGQPEIPAGRGEHPQGI------ 411
            |..:.|.||.   .:|::  ||........||.: ||         ||...:.|..:.|      
Zfish   141 GEDVNLFCLAVGRPEPTITWKDFKYGLLNEGEFLEIT---------EIKRHQAEDFECITNNGVA 196

  Fly   412 PEDTSPNDIMSEVDLQMEFATRIA----MESQLGDTLKSR------------------------- 447
            |.||      .:|.:.:.:...|.    |.:|:|.|...|                         
Zfish   197 PPDT------RKVKVTVNYPPIITDVKNMPAQVGKTAILRCEAMAVPTASFEWYRDDRRPVESDN 255

  Fly   448 -LRISNAQTTDT-----------GNYTCQPTT---ASSASVLV 475
             |:|.|.:|...           |||||..:.   ||:||:|:
Zfish   256 TLKIKNEKTRSLLLFTNVTEKHFGNYTCFASNRLGASNASMLL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 22/90 (24%)
IG_like 243..329 CDD:214653 22/89 (25%)
Ig 350..464 CDD:299845 33/166 (20%)
IG_like <441..477 CDD:214653 17/75 (23%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 22/96 (23%)
Ig 35..123 CDD:299845 21/94 (22%)
Ig 125..>183 CDD:299845 19/76 (25%)
I-set 128..207 CDD:254352 25/103 (24%)
IG_like 217..298 CDD:214653 18/80 (23%)
ig 223..296 CDD:278476 15/72 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.