DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and dpr6

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:316 Identity:112/316 - (35%)
Similarity:154/316 - (48%) Gaps:78/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKD 300
            |.||...|||:|...|.: |.:.|||.:|.:|:|||||.||:||||||:.|||||:|||.|..:|
  Fly    73 PYFDPSTPRNVTALMGKS-AYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQD 136

  Fly   301 SREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILN 365
            :.:|||.:|....:|:|:||||::|:|..|...:||::.    ..|.|.|.||||...||.|.|.
  Fly   137 TEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVV----PTATILGGPDLHVDKGSTINLT 197

  Fly   366 CLVQ---QPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQ 427
            |.|:   :|...    |:||..|.:|. :|:..|                               
  Fly   198 CTVKFSPEPPAY----IFWYHHEEVIN-YDSSRG------------------------------- 226

  Fly   428 MEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVIN------DENPAAM 486
                 .:::.::.||...|.|.|.||...|:|.|:|.|:.|..|||.|||:|      .|:|.||
  Fly   227 -----GVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAM 286

  Fly   487 QKSGACPCALG--PLQLLLHLLL--------------------LPELLLLRAGLAA 520
            | :|:..|...  .:.|||.|:|                    ||..|.|.|..||
  Fly   287 Q-TGSSGCQYNWLTIVLLLGLVLCYSSQQCSSAVPASLTSSLPLPSQLPLPAAAAA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 46/85 (54%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 269..272 CDD:409353 2/2 (100%)
Ig strand E 304..308 CDD:409353 3/3 (100%)
Ig strand F 318..323 CDD:409353 3/4 (75%)
IG_like <441..477 CDD:214653 17/35 (49%)
dpr6NP_001287018.1 FR1 79..96 CDD:409355 6/17 (35%)
IG_like 80..175 CDD:214653 49/95 (52%)
Ig strand A' 83..85 CDD:409355 0/1 (0%)
Ig strand B 89..97 CDD:409355 2/8 (25%)
CDR1 97..104 CDD:409355 2/6 (33%)
FR2 105..114 CDD:409355 7/8 (88%)
Ig strand C 105..110 CDD:409355 4/4 (100%)
CDR2 115..129 CDD:409355 10/13 (77%)
Ig strand D 129..135 CDD:409355 3/5 (60%)
FR3 130..159 CDD:409355 12/28 (43%)
Ig strand E 139..145 CDD:409355 3/5 (60%)
Ig strand F 153..160 CDD:409355 5/6 (83%)
IG_like 184..271 CDD:214653 35/127 (28%)
Ig strand B 194..198 CDD:409353 2/3 (67%)
Ig strand C 209..213 CDD:409353 1/7 (14%)
Ig strand E 240..244 CDD:409353 2/3 (67%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.