DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and NCAM2

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:327 Identity:65/327 - (19%)
Similarity:109/327 - (33%) Gaps:107/327 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 DAKRERSGAADEESQDADTSQSLPIFDFGMPRNITG----RTGHTEAIIKCRVDSLHDKSVSWIR 273
            ||...|..|.|.:.|..:.:..|.|:.....|.:..    :.|. :|.:.|||.|....:|||:.
Human   112 DAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSPQEFKQGE-DAEVVCRVSSSPAPAVSWLY 175

  Fly   274 KRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNII 338
            ..:       ..|..||.||.:..:.:     |.:......|.|||.|:...|.:..:.|:    
Human   176 HNE-------EVTTISDNRFAMLANNN-----LQILNINKSDEGIYRCEGRVEARGEIDFR---- 224

  Fly   339 EISPDAKAVISGPPDL-----HFKA----GSAIILNCLVQ---QPSVKDIGPIYWYRGEHMITPF 391
                |...:::.||.:     .|.|    |..:..:|...   :|::.      |:|...:|...
Human   225 ----DIIVIVNVPPAISMPQKSFNATAERGEEMTFSCRASGSPEPAIS------WFRNGKLIEEN 279

  Fly   392 DA-----------------DDGQPEI-----PAGRGE---------------------------- 406
            :.                 .||.|.:     .||..|                            
Human   280 EKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFVQPHIIQLKNETTYENGQVT 344

  Fly   407 -----HPQGIPEDTSPNDI----MSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYT 462
                 ..:.|||.|....:    .:|.|..::  .||.::.|.|   .|.|.|.:.:.:|:|.|.
Human   345 LVCDAEGEPIPEITWKRAVDGFTFTEGDKSLD--GRIEVKGQHG---SSSLHIKDVKLSDSGRYD 404

  Fly   463 CQ 464
            |:
Human   405 CE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 22/90 (24%)
IG_like 243..329 CDD:214653 22/89 (25%)
Ig 350..464 CDD:299845 32/184 (17%)
IG_like <441..477 CDD:214653 8/24 (33%)
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274 7/24 (29%)
I-set 47..136 CDD:254352 7/23 (30%)
I-set 142..218 CDD:254352 22/88 (25%)
IGc2 153..214 CDD:197706 20/73 (27%)
Ig 233..326 CDD:299845 16/98 (16%)
I-set 240..323 CDD:254352 14/88 (16%)
Ig5_NCAM-2 325..422 CDD:143278 17/87 (20%)
IG_like 333..420 CDD:214653 17/79 (22%)
IG_like 438..515 CDD:214653
IGc2 439..507 CDD:197706
FN3 521..613 CDD:238020
fn3 619..703 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.