Sequence 1: | NP_001014459.2 | Gene: | dpr3 / 3346208 | FlyBaseID: | FBgn0053516 | Length: | 522 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011527877.1 | Gene: | NCAM2 / 4685 | HGNCID: | 7657 | Length: | 874 | Species: | Homo sapiens |
Alignment Length: | 327 | Identity: | 65/327 - (19%) |
---|---|---|---|
Similarity: | 109/327 - (33%) | Gaps: | 107/327 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 213 DAKRERSGAADEESQDADTSQSLPIFDFGMPRNITG----RTGHTEAIIKCRVDSLHDKSVSWIR 273
Fly 274 KRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNII 338
Fly 339 EISPDAKAVISGPPDL-----HFKA----GSAIILNCLVQ---QPSVKDIGPIYWYRGEHMITPF 391
Fly 392 DA-----------------DDGQPEI-----PAGRGE---------------------------- 406
Fly 407 -----HPQGIPEDTSPNDI----MSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYT 462
Fly 463 CQ 464 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr3 | NP_001014459.2 | Ig | 243..330 | CDD:299845 | 22/90 (24%) |
IG_like | 243..329 | CDD:214653 | 22/89 (25%) | ||
Ig | 350..464 | CDD:299845 | 32/184 (17%) | ||
IG_like | <441..477 | CDD:214653 | 8/24 (33%) | ||
NCAM2 | XP_011527877.1 | Ig1_NCAM-2 | 46..137 | CDD:143274 | 7/24 (29%) |
I-set | 47..136 | CDD:254352 | 7/23 (30%) | ||
I-set | 142..218 | CDD:254352 | 22/88 (25%) | ||
IGc2 | 153..214 | CDD:197706 | 20/73 (27%) | ||
Ig | 233..326 | CDD:299845 | 16/98 (16%) | ||
I-set | 240..323 | CDD:254352 | 14/88 (16%) | ||
Ig5_NCAM-2 | 325..422 | CDD:143278 | 17/87 (20%) | ||
IG_like | 333..420 | CDD:214653 | 17/79 (22%) | ||
IG_like | 438..515 | CDD:214653 | |||
IGc2 | 439..507 | CDD:197706 | |||
FN3 | 521..613 | CDD:238020 | |||
fn3 | 619..703 | CDD:278470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |