DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and opcml

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:325 Identity:73/325 - (22%)
Similarity:119/325 - (36%) Gaps:87/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 NITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVK 309
            |||.|.|.: |::||.:|:...: |:|:.:..  ||..|...::.|.|. |..:....|:::.:.
Zfish    41 NITVRQGDS-AVLKCSMDNKVSR-VAWLNRTT--ILFTGNEKWSLDPRV-VLLNTAVNEYSIKIL 100

  Fly   310 APLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLV---QQP 371
            .....|.|.|.|.:.|..|........|:::   ...:::...|:....||.:.|.||.   .:|
Zfish   101 NVNLYDEGPYVCSILTNKKPESTKVHLIVQV---PARIVNVSTDVSVNEGSNVSLMCLAIGRPEP 162

  Fly   372 SVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTS-------PNDI----MSEVD 425
            |      |.|        .|.:..|...:..|......||.:|.|       .|||    :..|.
Zfish   163 S------ILW--------KFRSSKGNRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQ 213

  Fly   426 LQMEFATRIAMESQLGDTL-----------------------------------------KSRLR 449
            :.:.:...|:.....|..:                                         :|.|.
Zfish   214 VTVNYPPVISRARSTGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFNGVKIENKGKQSMLT 278

  Fly   450 ISNAQTTDTGNYTCQPTTA---SSASVLVH---VINDENPAAMQKSGACPCALGPLQLLLHLLLL 508
            ..|....|.|||||.....   ::||::::   .|:|.|.||:..:    |:|..|.|||.|.||
Zfish   279 FFNVSEEDYGNYTCVAINTLGITNASIILYGPGAIHDVNNAALSPT----CSLLLLTLLLTLSLL 339

  Fly   509  508
            Zfish   340  339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 24/84 (29%)
IG_like 243..329 CDD:214653 23/83 (28%)
Ig 350..464 CDD:299845 31/168 (18%)
IG_like <441..477 CDD:214653 12/82 (15%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 24/92 (26%)
IG_like 41..129 CDD:214653 24/92 (26%)
IG_like 139..216 CDD:214653 21/90 (23%)
IGc2 146..202 CDD:197706 16/69 (23%)
I-set 219..307 CDD:254352 13/87 (15%)
ig 223..307 CDD:278476 12/83 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.