DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and opcml

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:325 Identity:73/325 - (22%)
Similarity:119/325 - (36%) Gaps:87/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 NITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVK 309
            |||.|.|.: |::||.:|:...: |:|:.:..  ||..|...::.|.|. |..:....|:::.:.
Zfish    41 NITVRQGDS-AVLKCSMDNKVSR-VAWLNRTT--ILFTGNEKWSLDPRV-VLLNTAVNEYSIKIL 100

  Fly   310 APLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLV---QQP 371
            .....|.|.|.|.:.|..|........|:::   ...:::...|:....||.:.|.||.   .:|
Zfish   101 NVNLYDEGPYVCSILTNKKPESTKVHLIVQV---PARIVNVSTDVSVNEGSNVSLMCLAIGRPEP 162

  Fly   372 SVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTS-------PNDI----MSEVD 425
            |      |.|        .|.:..|...:..|......||.:|.|       .|||    :..|.
Zfish   163 S------ILW--------KFRSSKGNRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQ 213

  Fly   426 LQMEFATRIAMESQLGDTL-----------------------------------------KSRLR 449
            :.:.:...|:.....|..:                                         :|.|.
Zfish   214 VTVNYPPVISRARSTGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFNGVKIENKGKQSMLT 278

  Fly   450 ISNAQTTDTGNYTCQPTTA---SSASVLVH---VINDENPAAMQKSGACPCALGPLQLLLHLLLL 508
            ..|....|.|||||.....   ::||::::   .|:|.|.||:..:    |:|..|.|||.|.||
Zfish   279 FFNVSEEDYGNYTCVAINTLGITNASIILYGPGAIHDVNNAALSPT----CSLLLLTLLLTLSLL 339

  Fly   509  508
            Zfish   340  339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 23/83 (28%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 269..272 CDD:409353 1/2 (50%)
Ig strand E 304..308 CDD:409353 0/3 (0%)
Ig strand F 318..323 CDD:409353 2/4 (50%)
IG_like <441..477 CDD:214653 12/82 (15%)
opcmlNP_001005580.1 Ig 41..129 CDD:472250 24/92 (26%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 62..66 CDD:409353 1/4 (25%)
Ig strand E 95..99 CDD:409353 0/3 (0%)
Ig strand F 109..114 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 128..214 CDD:472250 22/102 (22%)
Ig strand B 150..154 CDD:409353 1/3 (33%)
Ig strand C 163..167 CDD:409353 3/17 (18%)
Ig strand E 181..185 CDD:409353 0/3 (0%)
Ig strand F 195..200 CDD:409353 0/4 (0%)
Ig 220..308 CDD:472250 13/87 (15%)
Ig strand B 236..240 CDD:409353 0/3 (0%)
Ig strand C 249..253 CDD:409353 0/3 (0%)
Ig strand E 275..279 CDD:409353 2/3 (67%)
Ig strand F 289..294 CDD:409353 4/4 (100%)
Ig strand G 302..305 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.