DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and DIP-gamma

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:266 Identity:65/266 - (24%)
Similarity:103/266 - (38%) Gaps:55/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 RSGAADEESQDADTSQSL---PIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHI 279
            :.|:...::|..::|..|   |.| .|...|:|...|. |||:.|.|.:|....|.|:|..|..:
  Fly    18 KCGSGSTQNQHHESSSQLDPDPEF-IGFINNVTYPAGR-EAILACSVRNLGKNKVGWLRASDQTV 80

  Fly   280 LTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEIS--P 342
            |.:.....|.:.|..|.. :|...|.|.:......|.|.|.||:||.|   |..|:..|::.  |
  Fly    81 LALQGRVVTHNARISVMH-QDMHTWKLKISKLRESDRGCYMCQINTSP---MKKQVGCIDVQVPP 141

  Fly   343 DAKAVIS--GPPDLHFKAGSAIILNC--------------------LVQQPSVKDIGPIYWYRGE 385
            |   :|:  ...||..:.|....|.|                    |:::|..:::..:..|.|.
  Fly   142 D---IINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGS 203

  Fly   386 HMITPFDADDGQPEIPAGRGEHPQ-----GIPEDTSPNDIMSEVDLQMEFATRIAMESQ-LGDTL 444
                         .:...|.|..|     .|..:..|..:...|.|.::||..:...|| ||..|
  Fly   204 -------------SLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPL 255

  Fly   445 KSRLRI 450
            .|.:::
  Fly   256 GSDVQL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 28/85 (33%)
Ig strand B 255..259 CDD:409353 2/3 (67%)
Ig strand C 269..272 CDD:409353 1/2 (50%)
Ig strand E 304..308 CDD:409353 2/3 (67%)
Ig strand F 318..323 CDD:409353 2/4 (50%)
IG_like <441..477 CDD:214653 3/10 (30%)
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 28/86 (33%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 19/112 (17%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 0/16 (0%)
Ig strand F 217..222 CDD:409562 0/4 (0%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 6/15 (40%)
Ig strand B 259..263 CDD:409358 0/3 (0%)
Ig strand C 272..276 CDD:409358
Ig strand E 317..326 CDD:409358
Ig strand F 336..341 CDD:409358
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.