DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and Ama

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:330 Identity:65/330 - (19%)
Similarity:109/330 - (33%) Gaps:96/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRK---RDLH--ILTVGTATYTS 289
            |:..|.|:.. .:.:::....|.: ....|.|:.:...||||.::   .|.:  :|::.......
  Fly    27 DSVLSAPVIS-QISKDVVASVGDS-VEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLP 89

  Fly   290 DKRFQVTESK----DSREWTLHVKAPLAKDSGIYECQV------NTEPKMSMAFQLN--IIEISP 342
            |:|:.||.::    .|..:|..::.....|.|.|||||      ....|:|:..:..  |.|.:|
  Fly    90 DQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTP 154

  Fly   343 DAKAVISGPPDLHFKAGSAIILNCLVQ---QPSVKDIGPIYWYRGEHMITPFDA----------- 393
            .:..|..         |..:.|.|...   :|::.      |.|..:.:.|...           
  Fly   155 KSTLVTE---------GQNLELTCHANGFPKPTIS------WAREHNAVMPAGGHLLAEPTLRIR 204

  Fly   394 ----------------DDGQPEIPAGRGE-------------------HP-------QGIPEDTS 416
                            .:|||:....|.|                   |.       ||.|   :
  Fly   205 SVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYP---A 266

  Fly   417 PNDIMSE--VDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTT-ASSASVLVHVI 478
            |..:..:  |.||......:|..:....|..|.|||.:....|.|:|.|..|. ...|...:|:.
  Fly   267 PTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLF 331

  Fly   479 NDENP 483
            ....|
  Fly   332 QTVIP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 22/100 (22%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 269..272 CDD:409353 2/2 (100%)
Ig strand E 304..308 CDD:409353 1/3 (33%)
Ig strand F 318..323 CDD:409353 3/4 (75%)
IG_like <441..477 CDD:214653 11/36 (31%)
AmaNP_731114.2 I-set 33..143 CDD:400151 25/111 (23%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 4/4 (100%)
Ig strand E 101..112 CDD:409353 2/10 (20%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 11/88 (13%)
I-set 254..330 CDD:400151 19/78 (24%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 2/3 (67%)
Ig strand F 312..317 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.