DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and dpr10

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:349 Identity:109/349 - (31%)
Similarity:159/349 - (45%) Gaps:105/349 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKD 300
            |.||..||||||...|.: |.:.|||..|.:|:|:|||.||||||||||.|||:|:|||.:..:|
  Fly    53 PYFDLTMPRNITSLVGKS-AYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRD 116

  Fly   301 SREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEI-------------SPDA-------- 344
            ..||||.:|....:|:|:||||::|:|..|.:..|||:::             :.||        
  Fly   117 IDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRV 181

  Fly   345 ---------------------KAVISGPPDLHFKAGSAIILNCLVQ---QPSVKDIGPIYWYRGE 385
                                 .|.|.|.|||:...||.|.|.|:::   :|...    |:||..:
  Fly   182 YQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTH----IFWYHQD 242

  Fly   386 HMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRI 450
            .:::                       |:||..        :::|.|..:.|:      ||.|.|
  Fly   243 KVLS-----------------------EETSGG--------RLKFKTIKSEET------KSILLI 270

  Fly   451 SNAQTTDTGNYTCQPTTASSASVLVHVINDENPAAMQKSG-------AC-PCALGP-------LQ 500
            .:|....:|.|:|.|:....||:.|||:..|.|.|||.:.       || .|..|.       :.
  Fly   271 YDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVIS 335

  Fly   501 LLLHLLLLPEL---LLLRAGLAAG 521
            .::..|:|.|.   |||::|...|
  Fly   336 TMVAALVLLEACSSLLLQSGGGGG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 47/86 (55%)
IG_like 243..329 CDD:214653 47/85 (55%)
Ig 350..464 CDD:299845 26/116 (22%)
IG_like <441..477 CDD:214653 12/35 (34%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 43/80 (54%)
IG_like 210..297 CDD:214653 30/127 (24%)
IGc2 217..287 CDD:197706 24/110 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444673
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.