DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and dpr10

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:349 Identity:109/349 - (31%)
Similarity:159/349 - (45%) Gaps:105/349 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKD 300
            |.||..||||||...|.: |.:.|||..|.:|:|:|||.||||||||||.|||:|:|||.:..:|
  Fly    53 PYFDLTMPRNITSLVGKS-AYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRD 116

  Fly   301 SREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEI-------------SPDA-------- 344
            ..||||.:|....:|:|:||||::|:|..|.:..|||:::             :.||        
  Fly   117 IDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRV 181

  Fly   345 ---------------------KAVISGPPDLHFKAGSAIILNCLVQ---QPSVKDIGPIYWYRGE 385
                                 .|.|.|.|||:...||.|.|.|:::   :|...    |:||..:
  Fly   182 YQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTH----IFWYHQD 242

  Fly   386 HMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRI 450
            .:::                       |:||..        :::|.|..:.|:      ||.|.|
  Fly   243 KVLS-----------------------EETSGG--------RLKFKTIKSEET------KSILLI 270

  Fly   451 SNAQTTDTGNYTCQPTTASSASVLVHVINDENPAAMQKSG-------AC-PCALGP-------LQ 500
            .:|....:|.|:|.|:....||:.|||:..|.|.|||.:.       || .|..|.       :.
  Fly   271 YDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVIS 335

  Fly   501 LLLHLLLLPEL---LLLRAGLAAG 521
            .::..|:|.|.   |||::|...|
  Fly   336 TMVAALVLLEACSSLLLQSGGGGG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 47/85 (55%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 269..272 CDD:409353 1/2 (50%)
Ig strand E 304..308 CDD:409353 3/3 (100%)
Ig strand F 318..323 CDD:409353 3/4 (75%)
IG_like <441..477 CDD:214653 12/35 (34%)
dpr10NP_729591.1 Ig 53..138 CDD:472250 47/85 (55%)
Ig strand B 71..75 CDD:409371 1/3 (33%)
Ig strand E 120..124 CDD:409371 3/3 (100%)
Ig_3 214..287 CDD:464046 24/113 (21%)

Return to query results.
Submit another query.