DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and ImpL2

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:201 Identity:37/201 - (18%)
Similarity:65/201 - (32%) Gaps:52/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 DGPTLSTFLSSSQSQSPS--------P-------PAASASASSPSSF----SSFAVAHGPQTEAT 190
            ||.|:........||.||        |       .:...:..:||:.    ||..:.| ..:||.
  Fly    72 DGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDH-VLSEAR 135

  Fly   191 NHTFKSLAFLDASFGSDLFAQTDAKRERSGAADEESQDADTSQSLPIFDFGMPRNITGRTGHTEA 255
            .:|     .:..:....::|.|.....||.....|.......:         ||.|.....|.:.
  Fly   136 TYT-----CVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQK---------PRIIYTEKTHLDL 186

  Fly   256 I-----IKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKD 315
            :     :.|||.:.....::|:...:..|:........::....::|.|    |         :|
  Fly   187 MGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLLISEIK----W---------ED 238

  Fly   316 SGIYEC 321
            .|.|:|
  Fly   239 MGNYKC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 16/84 (19%)
IG_like 243..329 CDD:214653 16/84 (19%)
Ig 350..464 CDD:299845
IG_like <441..477 CDD:214653
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 12/71 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.