DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and babos

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:184 Identity:45/184 - (24%)
Similarity:64/184 - (34%) Gaps:56/184 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 EESQDADTSQSLPIFDFG-------MPR----------------NITGRTGHTEAIIKCRVDS-L 264
            :.|.|.|..|:...||:|       .|:                ::||..|. :.::||.|.| |
  Fly    26 QSSMDDDQMQADDDFDYGGEDQSAPSPQTKSPNPVASEKINKTLSVTGIRGE-DVVLKCDVGSNL 89

  Fly   265 H--DKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQ----- 322
            |  |..|.|.         .|....::.|.......|....:.|.:.....:.:|.|.|:     
  Fly    90 HSSDVVVLWY---------FGDNVISNGKNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSG 145

  Fly   323 --VNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSA-IILNCLVQQPSV 373
              |||        ::.|.|.|.||.|    |......|||| ..|.|.|...:|
  Fly   146 SVVNT--------KVTIAEHSLDAIA----PESSTSAAGSASSFLGCTVLASTV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 23/112 (21%)
IG_like 243..329 CDD:214653 23/111 (21%)
Ig 350..464 CDD:299845 9/25 (36%)
IG_like <441..477 CDD:214653
babosNP_001286719.1 ig 70..154 CDD:278476 22/101 (22%)
IG_like 70..154 CDD:214653 22/101 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.