DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and CG13506

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:396 Identity:80/396 - (20%)
Similarity:130/396 - (32%) Gaps:116/396 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LDASF-GSDLFAQTDAKRERSGAADEESQDADTS------QSLPIFDFGMPRNITGRTGHTEAII 257
            :||.. |:|.  |.|.........|:::|..|.:      ::.|.||....| :..:.| .:.|:
  Fly    29 IDADVKGTDY--QDDEYEYGDDTDDDDTQIIDVTKNHAEQEAPPYFDVTDLR-VEAKPG-DDVIL 89

  Fly   258 KCRVDSLH-DKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYEC 321
            .|...:.. ..:|.|.:.|    :.:........:|.|...:.     ::.::....:||..|.|
  Fly    90 NCDARNFQLSNAVVWYKNR----IIIANGQNPISQRVQCMLNN-----SILLRNVSPEDSDDYYC 145

  Fly   322 Q-----VNTEPKMSMAFQLNII----EISPDAKAVISGPPDLHFKAGSAIILNCLVQQPSVKDIG 377
            :     |.....:.:..:|:|:    :|:..::.         |:.|....|.|....|   |..
  Fly   146 EILPQRVRQHTALRVGARLSILCDDRDITDRSQT---------FRQGDHHKLECRTYLP---DNA 198

  Fly   378 PIYW--------------YRGEHMITPFD----------ADDGQPEIPAGRGEHPQGIPEDTSPN 418
            .|.|              ..|..::...|          ||||....|.|.      :..|...:
  Fly   199 TIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGT------VHIDVQYS 257

  Fly   419 DIMS------------EVDLQMEFATRIAMES---------QLGD--TLKSRLRISNAQTT---- 456
            .|:|            ..:|...:..:....|         ||.|  :||..:...:.:||    
  Fly   258 PIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVR 322

  Fly   457 -----DTGNYTCQPTTA-SSASVLVHV-INDENP--AAMQKSGACPCALGPLQLLLHLLLLPELL 512
                 |.|.|.||...| .|..|.||| .|.|.|  ..|...|.        ::.||.|:....|
  Fly   323 EVTDSDLGEYLCQVENAIGSNEVKVHVSYNPETPQFEDMTVEGN--------KVTLHWLVRSHQL 379

  Fly   513 LLRAGL 518
            |..|.|
  Fly   380 LSEAML 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 14/92 (15%)
IG_like 243..329 CDD:214653 14/91 (15%)
Ig 350..464 CDD:299845 31/169 (18%)
IG_like <441..477 CDD:214653 14/47 (30%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 11/76 (14%)
IGc2 83..146 CDD:197706 11/72 (15%)
IG_like 176..254 CDD:214653 16/95 (17%)
Ig 176..239 CDD:299845 10/74 (14%)
I-set 258..349 CDD:254352 20/90 (22%)
Ig 275..348 CDD:143165 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.