DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and DIP-eta

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:325 Identity:77/325 - (23%)
Similarity:128/325 - (39%) Gaps:73/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQ 294
            |...|.||.      |:|...|. :|.:.|.|..|....|:|:|.....|||:.....|.::|..
  Fly    42 DPKFSSPIV------NMTAPVGR-DAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIG 99

  Fly   295 VTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGP--PDLHFK 357
            :..| :.:.||:.:|.....|.|.|.||:||:|..|....|::: :.||   ::..|  .|:..:
  Fly   100 IANS-EHKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVV-VPPD---ILDYPTSTDMVVR 159

  Fly   358 AGSAIILNCLV---QQPSV---KDIG-PIYWYRGEHMITPFDADDGQPEIPAGRGEHPQG----I 411
            .||.:.|.|..   .:|::   ::.| ||....||.:::....|...|.:    ..|..|    |
  Fly   160 EGSNVTLKCAATGSPEPTITWRRESGVPIELATGEEVMSIEGTDLVIPNV----RRHHMGAYLCI 220

  Fly   412 PEDTSPNDIMSEVDLQMEFATRIAMESQL-------GDTL---------------KSRLRI---- 450
            ..:..|..:...:.|.:.|...|.:::||       |.||               :.|..|    
  Fly   221 ASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRERGEIVPPG 285

  Fly   451 --SNAQTTDTGNYTCQPTTASSASVLVHVINDENPAAMQKSGACPC----ALGPLQLLLHLLLLP 509
              .:|..|:.|.|        ..|:.:|:    ||....:.|:..|    :||.....:.|..:|
  Fly   286 GKYSANVTEIGGY--------RNSMRLHI----NPLTQAEFGSYRCVAKNSLGDTDGTIKLYRIP 338

  Fly   510  509
              Fly   339  338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 27/85 (32%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 269..272 CDD:409353 1/2 (50%)
Ig strand E 304..308 CDD:409353 2/3 (67%)
Ig strand F 318..323 CDD:409353 2/4 (50%)
IG_like <441..477 CDD:214653 10/56 (18%)
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 28/87 (32%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 108..112 CDD:409353 2/3 (67%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
IgI_1_MuSK 145..237 CDD:409562 21/98 (21%)
Ig strand A 145..148 CDD:409562 2/5 (40%)
Ig strand A' 153..158 CDD:409562 1/4 (25%)
Ig strand B 164..171 CDD:409562 2/6 (33%)
Ig strand C 177..182 CDD:409562 0/4 (0%)
Ig strand C' 184..186 CDD:409562 0/1 (0%)
Ig strand D 194..197 CDD:409562 1/2 (50%)
Ig strand E 202..208 CDD:409562 1/5 (20%)
Ig strand F 215..222 CDD:409562 2/6 (33%)
Ig strand G 229..237 CDD:409562 1/7 (14%)
IG_like 252..335 CDD:214653 17/94 (18%)
Ig strand B 258..262 CDD:409353 2/3 (67%)
Ig strand C 271..282 CDD:409353 1/10 (10%)
Ig strand E 301..306 CDD:409353 1/4 (25%)
Ig strand F 316..321 CDD:409353 1/4 (25%)
Ig strand G 329..332 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.