DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and itgb4

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 / 335269 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio


Alignment Length:325 Identity:63/325 - (19%)
Similarity:102/325 - (31%) Gaps:131/325 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 NITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVK 309
            |:....|..:||::..|  ..|: :.| ||...|:|...|                  |...|.:
Zfish   226 NLDAPEGGFDAILQTAV--CQDQ-IGW-RKDSTHLLVFST------------------ESAFHYE 268

  Fly   310 APLAK------DSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLV 368
            |..|.      |....:|.:|.:...:.       ::..|..::    |.|         :..||
Zfish   269 ADGANVLAGILDRNDEQCHLNVDGNYTH-------DVRQDYPSI----PTL---------VRLLV 313

  Fly   369 QQPSVKDIGPIY--------WYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSP-------- 417
            :.    :|.||:        :|...|...|. |:.||             :.||:|.        
Zfish   314 KH----NIIPIFAVTNHSYSYYEKLHEYFPI-AELGQ-------------LQEDSSNILSILEKA 360

  Fly   418 -NDIMSEVDLQMEFATRIAMESQL-----------------GDTLKSRLRISNA----------- 453
             .:|.|::.::.|...: |:|:::                 |.|.|.::|:...           
Zfish   361 FENIRSKISIRAEDRPK-AVETKIFSQSGTFSEYGNFKITPGQTGKFKVRMKALNQVGEEPVCKV 424

  Fly   454 -QTTDTGNYTCQPTTASS-----ASVLVHVINDENPAAMQK----------SGACPCA---LGPL 499
             |....|....:|||.||     |.||....:.|.......          .|.|.|.   ||||
Zfish   425 NQADRAGTLRVKPTTFSSAFKINAEVLCPTCDCEKTPVKNAVRCTGHGDLVCGKCQCYAGWLGPL 489

  Fly   500  499
            Zfish   490  489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 19/90 (21%)
IG_like 243..329 CDD:214653 19/89 (21%)
Ig 350..464 CDD:299845 27/159 (17%)
IG_like <441..477 CDD:214653 14/52 (27%)
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776 55/291 (19%)
EGF_2 <468..490 CDD:285248 7/22 (32%)
EGF_2 545..573 CDD:285248
Integrin_B_tail 625..709 CDD:285239
Calx-beta 991..1064 CDD:295344
FN3 1242..1326 CDD:238020
FN3 1331..1420 CDD:238020
fn3 1640..1720 CDD:278470
fn3 1751..1835 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.