DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and dpr2

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:402 Identity:186/402 - (46%)
Similarity:232/402 - (57%) Gaps:100/402 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 IMALVVSI-----MQQQQQSLLWPFCNGLAAAAASTGQPDDSGDGPTLSTFLSSSQSQSPSPPAA 166
            |:.:::||     ||||.                                 ||.:..|.|:..:.
  Fly    15 ILVIMISISRAWTMQQQH---------------------------------LSPAIQQHPAVKSL 46

  Fly   167 S----------ASASSPSSFSSFAVAHGPQTEATNHTFKSLAFLDASFGSDLFAQTDAKRERSGA 221
            |          ...|:|||..:..|    ...:.|..|       ..||:.:    |.:||.   
  Fly    47 SHLVDGNDNLLPMVSAPSSIDNDYV----YIASVNRKF-------PQFGNSI----DDEREA--- 93

  Fly   222 ADEESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTAT 286
              ||....:|:...|:||||||||||.||||| |.|.||||:|.||||||||||||||||.|..|
  Fly    94 --EEQPPEETTYPPPVFDFGMPRNITTRTGHT-AAINCRVDNLGDKSVSWIRKRDLHILTAGILT 155

  Fly   287 YTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGP 351
            ||||:||:|..:.||::||||||....:||||||||||||||:||||:||:|...|||||:|:||
  Fly   156 YTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGP 220

  Fly   352 PDLHFKAGSAIILNCLVQQP--SVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPED 414
            .||:.|.||::.|.|.|:||  |.:||||||||||.:::|||.|                     
  Fly   221 TDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVA--------------------- 264

  Fly   415 TSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVIN 479
             .|||  :.:|||     ||:|||.|.:.|:|||||:|||..|||||||.||||.:|||:|:|||
  Fly   265 -HPND--AAIDLQ-----RISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVIN 321

  Fly   480 DENPAAMQKSGA 491
            ||:|||||||.|
  Fly   322 DESPAAMQKSRA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 64/86 (74%)
IG_like 243..329 CDD:214653 63/85 (74%)
Ig 350..464 CDD:299845 54/115 (47%)
IG_like <441..477 CDD:214653 24/35 (69%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 69/93 (74%)
Ig 116..192 CDD:299845 54/76 (71%)
ig 220..306 CDD:278476 53/114 (46%)
IG_like 220..306 CDD:214653 53/114 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447421
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104656at50557
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 1 1.000 - - otm49652
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.