DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and dpr4

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:274 Identity:113/274 - (41%)
Similarity:153/274 - (55%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQ 294
            :|..|.|.||....|.:|...|.. |::.|||.:|.|::|||||||||||||||..|||:|:|||
  Fly    39 ETPYSQPYFDNSSRREVTATVGQA-ALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQ 102

  Fly   295 VTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAG 359
            ...|:.|.||||.:.:|..:|||.|||||:||||:|..|:||::.    ::|.|.|..:|..|:|
  Fly   103 SLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVV----SRAKILGNAELFIKSG 163

  Fly   360 SAIILNCLVQQ----PSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDI 420
            |.|.|.||..|    ||.     ||||:|:.::.           .:.||    ||       ::
  Fly   164 SDINLTCLAMQSPVPPSF-----IYWYKGKRVMN-----------YSQRG----GI-------NV 201

  Fly   421 MSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVINDENPAA 485
            ::|                 ..|..|:|.|:.|...|:|||||.|:::.||||:|||||.|:|||
  Fly   202 ITE-----------------RSTRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAA 249

  Fly   486 MQKSGACPCALGPL 499
            ||...:....|.||
  Fly   250 MQHGNSSATCLRPL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 50/86 (58%)
IG_like 243..329 CDD:214653 49/85 (58%)
Ig 350..464 CDD:299845 32/117 (27%)
IG_like <441..477 CDD:214653 17/35 (49%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 54/93 (58%)
IG_like 53..145 CDD:214653 53/92 (58%)
ig 153..227 CDD:278476 31/117 (26%)
IG_like 161..>227 CDD:214653 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444737
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.