DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:258 Identity:66/258 - (25%)
Similarity:98/258 - (37%) Gaps:68/258 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 DFGMP-RNITGRTGHTEAIIKCRVDSL--HDKS---------VSWIRKRDLHILTVGTATYTSDK 291
            ||.:| .|:|...|. :|...|.|::|  |..|         |:||:.....||.:.....|::.
  Fly    99 DFVIPLENVTIAQGR-DATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNND 162

  Fly   292 RFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPD-AKAVISGPPDLH 355
            |..| :..|...|||:::....:|:|.|.|||||:|.......|.:: |.|| .....||  |:.
  Fly   163 RLSV-QHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVV-IPPDIINEETSG--DMM 223

  Fly   356 FKAGSAIILNCLVQ-QPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPND 419
            ...|.:..|.|..: .|..|    |.|.|          :||: ||.|..|.|     :.|....
  Fly   224 VPEGGSAKLVCRARGHPKPK----ITWRR----------EDGR-EIIARNGSH-----QKTKAQS 268

  Fly   420 IMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTC------QPTTASSASVLVH 476
            :..|:                       |.:|....::.|.|.|      .||.:....:.||
  Fly   269 VEGEM-----------------------LTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVH 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 31/98 (32%)
IG_like 243..329 CDD:214653 31/97 (32%)
Ig 350..464 CDD:299845 24/120 (20%)
IG_like <441..477 CDD:214653 9/42 (21%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 34/112 (30%)
ig 102..195 CDD:278476 28/94 (30%)
IG_like 219..307 CDD:214653 27/132 (20%)
Ig 221..307 CDD:299845 25/128 (20%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.