DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and dpr8

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:313 Identity:108/313 - (34%)
Similarity:154/313 - (49%) Gaps:64/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 SGAADEESQD--ADTSQSL-------PIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRK 274
            :|..|..|:.  .|..|.|       |.||..:..||||..|.| ..:.|||.:|.:::|||:|.
  Fly    16 AGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKT-VKLTCRVKNLGNRTVSWVRH 79

  Fly   275 RDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIE 339
            ||:|:||||..|||||:||:...|..:.:|||.::....|||||||||::|.|.:..:..|||:|
  Fly    80 RDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVE 144

  Fly   340 ISPDAKAVISGPPDLHFKAGSAIILNCLVQ-----QPSVKDIGPIYWYRGEHMITPFDADDGQPE 399
            ...|    |.|.|:||...||.|.|.|:|:     .|:|      .|.....:|. ||:      
  Fly   145 PVTD----IIGGPELHINRGSTINLTCIVKFAPEPPPTV------IWSHNREIIN-FDS------ 192

  Fly   400 IPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQ 464
                    |:|                      .|::.::.|....|||.:..|.|.|:|.|||.
  Fly   193 --------PRG----------------------GISLVTEKGVLTTSRLLVQKAITQDSGLYTCT 227

  Fly   465 PTTASSASVLVHVINDENPAAMQ--KSGACPCALGPLQLLLHLLLLPELLLLR 515
            |:.|:..||.||:::.|:||||.  .:|....:..|:.|.|.||....|:||:
  Fly   228 PSNANPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 43/85 (51%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 269..272 CDD:409353 2/2 (100%)
Ig strand E 304..308 CDD:409353 3/3 (100%)
Ig strand F 318..323 CDD:409353 4/4 (100%)
IG_like <441..477 CDD:214653 16/35 (46%)
dpr8NP_727781.1 IG_like 51..131 CDD:214653 41/80 (51%)
Ig strand B 60..64 CDD:409353 0/3 (0%)
Ig strand C 73..77 CDD:409353 2/3 (67%)
Ig strand E 109..113 CDD:409353 3/3 (100%)
Ig strand F 123..128 CDD:409353 4/4 (100%)
Ig_3 153..230 CDD:464046 30/119 (25%)

Return to query results.
Submit another query.