DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and dpr8

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:313 Identity:108/313 - (34%)
Similarity:154/313 - (49%) Gaps:64/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 SGAADEESQD--ADTSQSL-------PIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRK 274
            :|..|..|:.  .|..|.|       |.||..:..||||..|.| ..:.|||.:|.:::|||:|.
  Fly    16 AGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKT-VKLTCRVKNLGNRTVSWVRH 79

  Fly   275 RDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIE 339
            ||:|:||||..|||||:||:...|..:.:|||.::....|||||||||::|.|.:..:..|||:|
  Fly    80 RDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVE 144

  Fly   340 ISPDAKAVISGPPDLHFKAGSAIILNCLVQ-----QPSVKDIGPIYWYRGEHMITPFDADDGQPE 399
            ...|    |.|.|:||...||.|.|.|:|:     .|:|      .|.....:|. ||:      
  Fly   145 PVTD----IIGGPELHINRGSTINLTCIVKFAPEPPPTV------IWSHNREIIN-FDS------ 192

  Fly   400 IPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQ 464
                    |:|                      .|::.::.|....|||.:..|.|.|:|.|||.
  Fly   193 --------PRG----------------------GISLVTEKGVLTTSRLLVQKAITQDSGLYTCT 227

  Fly   465 PTTASSASVLVHVINDENPAAMQ--KSGACPCALGPLQLLLHLLLLPELLLLR 515
            |:.|:..||.||:::.|:||||.  .:|....:..|:.|.|.||....|:||:
  Fly   228 PSNANPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 43/86 (50%)
IG_like 243..329 CDD:214653 43/85 (51%)
Ig 350..464 CDD:299845 29/118 (25%)
IG_like <441..477 CDD:214653 16/35 (46%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 41/80 (51%)
V-set 52..143 CDD:284989 44/91 (48%)
IG_like 153..238 CDD:214653 33/127 (26%)
ig 153..232 CDD:278476 30/121 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.