DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and dpr14

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:309 Identity:93/309 - (30%)
Similarity:136/309 - (44%) Gaps:78/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 TDAKRERSG---------------------AADEESQDADTSQSLPIFDFGMP---RNITGRTGH 252
            |..||.|:|                     ..|||.:..:|:...|...|..|   .||:.:.. 
  Fly    26 TTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLS- 89

  Fly   253 TEAIIKCRVDSLHDKSVSWIRKR--DLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKD 315
            :...:.|||:.|..|:|||:|:|  ||.::|.|..||:.|.|:.: |.::..:|.|.::....:|
  Fly    90 SSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSL-EFEEPNDWKLLIQFANERD 153

  Fly   316 SGIYECQVNTEPKMSMAFQLNII----EISPDAKAVISGPPDLHFKAGSAIILNCLVQQ---PSV 373
            .|.|||||::.|.:.:...|.||    ||..:..   |..|:.::||||.|.|.|::.:   || 
  Fly   154 EGPYECQVSSHPPLVLLVYLTIIVPHVEILDERG---SATPEKYYKAGSTIELQCVISKIPHPS- 214

  Fly   374 KDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMES 438
               ..|.|..|                       |:.:..|||...|..:.|:            
  Fly   215 ---SYITWRHG-----------------------PRLLNYDTSRGGISVKTDM------------ 241

  Fly   439 QLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVINDENPAAMQ 487
             |.....|||.|:||...|||||||......:.:|:|||:|.|.|||||
  Fly   242 -LPGRALSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQ 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 32/91 (35%)
IG_like 243..329 CDD:214653 32/90 (36%)
Ig 350..464 CDD:299845 32/116 (28%)
IG_like <441..477 CDD:214653 15/35 (43%)
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 30/81 (37%)
Ig 84..169 CDD:299845 30/86 (35%)
IG_like 191..279 CDD:214653 35/127 (28%)
Ig 201..274 CDD:143165 28/112 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444718
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.