DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and Dscaml1

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001101611.1 Gene:Dscaml1 / 315615 RGDID:1304887 Length:2111 Species:Rattus norvegicus


Alignment Length:411 Identity:84/411 - (20%)
Similarity:142/411 - (34%) Gaps:139/411 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 TDAKRERSGAAD-EESQDADTSQ--SLPIFDFGMPRNITGRTGHTEAIIK--------CRVDSLH 265
            :.|::..|||.. ..::.|.|:|  ::.:.:.|.||.:   :..:|.::.        |......
  Rat   432 SSAQKSHSGAYQCFATRKAQTAQDFAIIVLEDGTPRIV---SSFSEKVVNPGEQFSLMCAAKGAP 493

  Fly   266 DKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMS 330
            ..:|:|... |..::..|     |.:..|.|.|..:....::|..|..:|.|:|.|....... |
  Rat   494 PPTVTWALD-DEPVVRDG-----SHRTNQYTMSDGTTISHMNVTGPQIRDGGVYRCTARNSVG-S 551

  Fly   331 MAFQLNIIEISPDAKAVISGPPDLHFK------AGSAIILNCLVQQPSVKDIG-PIY---WYR-- 383
            ..:|         |:..:.|||.:...      ||...::||.|       || |.|   ||:  
  Rat   552 AEYQ---------ARINVRGPPSIRAMRNITAVAGRDTLINCRV-------IGYPYYSIKWYKDA 600

  Fly   384 ----GEHMITPFD------------ADDG--------QPEIPAGRGEH------PQGIPEDTSPN 418
                ..|....|:            .|:|        ||::...:..|      |...|.:..|.
  Rat   601 LLLPDNHRQVVFENGTLKLTDVQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQPFEFPPA 665

  Fly   419 DI---------MSEVDLQMEFATRIAMESQL-----GDTLKSR-----LRISNAQTTDTGNYTCQ 464
            .|         :|..|:.:....|  .:.|:     |.|::|:     |:||:......||||| 
  Rat   666 SIGQLLYIPCVVSSGDMPIRITWR--KDGQVIISGSGVTIESKEFMSSLQISSVSLKHNGNYTC- 727

  Fly   465 PTTASSASVLV-------------HVINDENPAAMQ-KSGACPCALG------------------ 497
              .||:|:..|             .|:...|...:. |:|...|::.                  
  Rat   728 --IASNAAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKVMWKHAKGSGNP 790

  Fly   498 ----PLQLLLHLLLLPELLLL 514
                |:.|...:.:||...||
  Rat   791 QQYHPVPLTGRIQILPNSSLL 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 18/94 (19%)
IG_like 243..329 CDD:214653 18/93 (19%)
Ig 350..464 CDD:299845 39/174 (22%)
IG_like <441..477 CDD:214653 15/53 (28%)
Dscaml1NP_001101611.1 IG 101..173 CDD:214652
IGc2 101..168 CDD:197706
Ig 183..276 CDD:299845
IG_like 195..276 CDD:214653
I-set 291..369 CDD:254352
IGc2 298..359 CDD:197706
IGc2 386..447 CDD:197706 4/14 (29%)
I-set 466..560 CDD:254352 21/112 (19%)
Ig 466..556 CDD:299845 20/108 (19%)
IGc2 577..635 CDD:197706 14/64 (22%)
IG_like 665..744 CDD:214653 20/83 (24%)
Ig 673..739 CDD:143165 19/70 (27%)
I-set 748..843 CDD:254352 11/64 (17%)
Ig7_DSCAM 765..843 CDD:143211 8/47 (17%)
I-set 849..942 CDD:254352
Ig 861..949 CDD:299845
FN3 945..1039 CDD:238020
FN3 1046..1143 CDD:238020
fn3 1151..1237 CDD:278470
FN3 1249..1340 CDD:238020
IGc2 1364..1428 CDD:197706
FN3 1442..1532 CDD:238020
FN3 1546..1618 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.