DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:281 Identity:69/281 - (24%)
Similarity:106/281 - (37%) Gaps:73/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 NITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVK 309
            |::...|. :|...|.|..|....|.|::.....|..:.....|.:.|..|:. .|...|.||:|
  Fly    50 NVSVAVGR-DATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSH-LDQNTWNLHIK 112

  Fly   310 APLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVIS--GPPDLHFKAGSAIILNCLVQ--- 369
            |...:|.|.|.||:||:|..|....|::: |.||   .||  ...|:....||::.|.|..:   
  Fly   113 AVSEEDRGGYMCQLNTDPM
KSQIGFLDVV-IPPD---FISEDTSSDVIVPEGSSVRLTCRARGYP 173

  Fly   370 QPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRI 434
            :|.|.      |.|          :||                         :|:.|:....|:.
  Fly   174 EPIVT------WRR----------EDG-------------------------NEIVLKDNVGTKT 197

  Fly   435 AMESQLGDTLKSRLRISNAQTTDTGNYTC------QPTTASSASVLVH---VINDENPAAMQKSG 490
            ...|..|:.||    :|.....:.|:|.|      .|:.:...|:.:|   ||...|    |..|
  Fly   198 LAPSFRGEVLK----LSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPN----QLVG 254

  Fly   491 ACPCALG-PLQLLLHLLLLPE 510
            |   .|| .:|:..|:...|:
  Fly   255 A---PLGTDVQIECHVEASPK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 26/84 (31%)
IG_like 243..329 CDD:214653 26/83 (31%)
Ig 350..464 CDD:299845 22/122 (18%)
IG_like <441..477 CDD:214653 10/44 (23%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 24/80 (30%)
Ig 51..131 CDD:299845 24/81 (30%)
I-set 144..240 CDD:254352 28/143 (20%)
IGc2 159..228 CDD:197706 21/113 (19%)
Ig 244..337 CDD:299845 11/36 (31%)
I-set 244..337 CDD:254352 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.