DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and rst

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:491 Identity:102/491 - (20%)
Similarity:160/491 - (32%) Gaps:152/491 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RRSGADDVDVIEPRSPGHAADVDVAAAAAGATTSVAATAAAAAAATTRAAATTRAVIIIMALVVS 113
            ||..|..|..:.|:...|             .|:.:..|...|..|.|:|.....|.....:.|:
  Fly   191 RRFTAKSVLRLTPKKEHH-------------NTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVN 242

  Fly   114 IMQQQQQSLLWPFCNGLAAAAASTGQPDDSGDG----PTLSTFLSSSQSQSPSPPAASASASSPS 174
            :|            ..|...|.  |....:|.|    .|.|..:..||.:     ....:.::||
  Fly   243 VM------------GSLPGGAG--GSVGGAGGGSVHMSTGSRIVEHSQVR-----LECRADANPS 288

  Fly   175 S------FSSFAVAHGPQTEAT--NHTFKSLAFLDASFGSDLFAQTDAKRERSGAADEESQDADT 231
            .      .:...:..|.:||..  |.|.|   |.||....::        :.|....|:|:..|.
  Fly   289 DVRYRWFINDEPIIGGQKTEMVIRNVTRK---FHDAIVKCEV--------QNSVGKSEDSETLDI 342

  Fly   232 SQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVT 296
            |.: |.|. ..|:::....|...: :.|.|||.....:.||:.....:  |||:|   :..|.|:
  Fly   343 SYA-PSFR-QRPQSMEADVGSVVS-LTCEVDSNPQPEIVWIQHPSDRV--VGTST---NLTFSVS 399

  Fly   297 ESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDL------H 355
            .                :.:|.|.|:.|..         ...|||.||...:.|.|.:      :
  Fly   400 N----------------ETAGRYYCKANVP---------GYAEISADAYVYLKGSPAIGSQRTQY 439

  Fly   356 FKAGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDI 420
            ...|....:.|...  ||.        |..|:...|   :|| ||.:..| |...|..|..|..:
  Fly   440 GLVGDTARIECFAS--SVP--------RARHVSWTF---NGQ-EISSESG-HDYSILVDAVPGGV 489

  Fly   421 MSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVIND--ENP 483
                                    ||.|.|.::|....|.|.|.            |:||  .:.
  Fly   490 ------------------------KSTLIIRDSQAYHYGKYNCT------------VVNDYGNDV 518

  Fly   484 AAMQKSGACPCAL-----GPLQLLLHLLLLPELLLL 514
            |.:|.......:|     |.:.::..||:|..|:::
  Fly   519 AEIQLQAKKSVSLLMTIVGGISVVAFLLVLTILVVV 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 18/86 (21%)
IG_like 243..329 CDD:214653 18/85 (21%)
Ig 350..464 CDD:299845 25/119 (21%)
IG_like <441..477 CDD:214653 8/35 (23%)
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423 10/46 (22%)
Ig_3 265..329 CDD:290638 15/79 (19%)
I-set 346..420 CDD:254352 22/105 (21%)
Ig 360..425 CDD:299845 22/95 (23%)
Ig5_KIRREL3-like 428..524 CDD:143235 31/146 (21%)
IG_like 435..524 CDD:214653 29/139 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.