DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and Kirrel1

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:256 Identity:56/256 - (21%)
Similarity:92/256 - (35%) Gaps:67/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 PRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLH 307
            |.:.|...|| .|::.| |...:...|.|  .:|...|.:|.. ..:..|::|..|.|:.::.|.
  Rat    59 PADQTVVAGH-RAVLPC-VLLNYSGIVQW--TKDGLALGMGQG-LKAWPRYRVVGSADAGQYNLE 118

  Fly   308 VKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQQPS 372
            :......|...||||.......|...:|.::....|.:  |.|.|.:..:||:...|.|  :..:
  Rat   119 ITDAELSDDASYECQATEAALRSRRAKLTVLIPPEDTR--IDGGPVILLQAGTPYNLTC--RAFN 179

  Fly   373 VKDIGPIYWYR------------------------GEHMITPFDADDGQ--------PEIPAGRG 405
            .|....|.|:|                        .:.:|.|.|.|.|:        ..||.|: 
  Rat   180 AKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIQPTDLDIGRVFTCRSMNEAIPNGK- 243

  Fly   406 EHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPT 466
                    :||     .|:|:.......:::|.|   |:....|:.         :|||.|
  Rat   244 --------ETS-----IELDVHHPPTVTLSIEPQ---TVLEGERVI---------FTCQAT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 22/86 (26%)
IG_like 243..329 CDD:214653 22/85 (26%)
Ig 350..464 CDD:299845 27/145 (19%)
IG_like <441..477 CDD:214653 6/26 (23%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 24/93 (26%)
Ig 57..148 CDD:299845 24/93 (26%)
Ig2_KIRREL3-like 170..251 CDD:143236 17/96 (18%)
I-set 255..336 CDD:254352 8/37 (22%)
Ig_2 259..337 CDD:290606 8/33 (24%)
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.