DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and Dscam4

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster


Alignment Length:558 Identity:99/558 - (17%)
Similarity:158/558 - (28%) Gaps:218/558 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 QPDDSGDGPTLSTFLSSSQSQSPSPPAASASASSPSS---FSSFAVAHGPQTE----ATNHTFKS 196
            |.:|.|   ....|:|:...|..|........:||..   ||...:..||...    ||.:....
  Fly   391 QKEDPG---MYQCFVSNEWEQIQSTAELQLGDASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQ 452

  Fly   197 LAF-LD---------------ASFGSDLFAQ---TDAKRERSGAADEESQDA--DTSQSLPIFDF 240
            ..: ||               .:...|:.:.   ::.|.|..|.....:|:|  ..|.|..:..:
  Fly   453 FTWSLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIY 517

  Fly   241 GMP-----RNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKD 300
            |:|     ..|||.:| ::.|:||.|.......:.|  :||...|.:.......:....:.|...
  Fly   518 GLPYIREMPKITGISG-SDLIVKCPVAGYPIDKIHW--ERDGQTLPINRRQRAYNNGTLIIEQLQ 579

  Fly   301 SREWTLHVKAPLAKDSGIYEC----------------QVNTEPK--------------MSMAFQL 335
            ..|           |:|.|.|                ||...||              |..|...
  Fly   580 RLE-----------DAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIMPIQAMTNMLREGMRAAISC 633

  Fly   336 NIIE--------------------------------------ISPD------------------- 343
            .|:|                                      ||.|                   
  Fly   634 QILEGDLPVSFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFT 698

  Fly   344 AKAVISGPP-------DLHFKAGSAIILNCL---VQQPSV---KDIGPI------YWYRGEHMIT 389
            ....::.||       |...:||:.::|:|.   ...|::   |.|||.      :.|.....:.
  Fly   699 VPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQLF 763

  Fly   390 P------------------------------------------FDADDGQPEIPAGRGEHPQGIP 412
            |                                          |.....|..:..|:..|.|...
  Fly   764 PNGTIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNV 828

  Fly   413 EDTSPNDIMSEVDLQMEFA-----TRIAMESQ-LGDTLKSRLRISNAQTTDTGNYTCQPTTA--- 468
            :..:|.|...::....::.     :|..:..| |.|.:.|.|.||:....|||.|.||.:.|   
  Fly   829 QGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQ 893

  Fly   469 --SSASVLVHV---------INDENPAAMQKSGACPCA 495
              .|..::|..         ||.:...::|.:.:.|.|
  Fly   894 DEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFA 931

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 23/121 (19%)
IG_like 243..329 CDD:214653 23/120 (19%)
Ig 350..464 CDD:299845 33/180 (18%)
IG_like <441..477 CDD:214653 14/40 (35%)
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 7/28 (25%)
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549
Ig strand F 397..402 CDD:409549 0/4 (0%)
Ig strand G 410..413 CDD:409549 1/2 (50%)
IgI_4_Dscam 422..516 CDD:409548 17/93 (18%)
Ig strand B 439..443 CDD:409548 0/3 (0%)
Ig strand C 452..456 CDD:409548 0/3 (0%)
Ig strand E 482..486 CDD:409548 0/3 (0%)
Ig strand F 496..501 CDD:409548 0/4 (0%)
Ig strand G 509..512 CDD:409548 1/2 (50%)
IgI_5_Dscam 520..607 CDD:409550 19/100 (19%)
Ig strand B 536..540 CDD:409550 1/3 (33%)
Ig strand C 549..553 CDD:409550 1/5 (20%)
Ig strand E 571..575 CDD:409550 0/3 (0%)
Ig strand F 586..591 CDD:409550 2/4 (50%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 9/92 (10%)
Ig strand A 611..613 CDD:409353 1/1 (100%)
Ig strand A' 620..624 CDD:409353 0/3 (0%)
Ig strand B 627..636 CDD:409353 2/8 (25%)
Ig strand C 641..648 CDD:409353 0/6 (0%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 0/6 (0%)
Ig strand F 682..690 CDD:409353 0/7 (0%)
Ig strand G 693..702 CDD:409353 0/8 (0%)
IgI_7_Dscam 706..801 CDD:409546 14/94 (15%)
Ig strand B 724..728 CDD:409546 1/3 (33%)
Ig strand C 737..741 CDD:409546 0/3 (0%)
Ig strand E 766..770 CDD:409546 0/3 (0%)
Ig strand F 780..785 CDD:409546 0/4 (0%)
Ig strand G 794..797 CDD:409546 0/2 (0%)
Ig 818..904 CDD:416386 22/85 (26%)
putative Ig strand B 820..827 CDD:409353 2/6 (33%)
putative Ig strand C 835..841 CDD:409353 1/5 (20%)
putative Ig strand C' 853..856 CDD:409353 1/2 (50%)
putative Ig strand D 862..866 CDD:409353 2/3 (67%)
putative Ig strand E 868..874 CDD:409353 3/5 (60%)
putative Ig strand F 881..889 CDD:409353 4/7 (57%)
putative Ig strand G 892..902 CDD:409353 1/9 (11%)
FN3 906..999 CDD:238020 5/26 (19%)
FN3 1006..1110 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.