DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and dpr1

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:347 Identity:131/347 - (37%)
Similarity:165/347 - (47%) Gaps:106/347 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SPSPPAASASASSPSSFSSFAVAHGPQTEATNHTFKSLAFLDASFGSDLFAQTDAKRERSGAADE 224
            :|:||..|.:..|||:.                                                
  Fly    35 APTPPTTSTTTISPSNL------------------------------------------------ 51

  Fly   225 ESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTS 289
                      ||.|||.:|||:|...|.| ..:.|||:.|.||.|||||||||||||.|..||||
  Fly    52 ----------LPYFDFDVPRNLTVTVGQT-GFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTS 105

  Fly   290 DKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDL 354
            |:||||.....|..|||.:|.|..:|||:||||:|||||||:::..|::|:    ||.|.||.||
  Fly   106 DQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVEL----KAEIFGPSDL 166

  Fly   355 HFKAGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPND 419
            ..|.||.|.|.|.:.| ...::|.|:||:|..|:.             |:||             
  Fly   167 MVKTGSDINLTCKIMQ-GPHELGNIFWYKGSEMLD-------------GKGE------------- 204

  Fly   420 IMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVINDENPA 484
              :|:|..|   .||.:|....|.|.|||:|..|...|||||||.||.|.::||.||||..|:||
  Fly   205 --NEIDSSM---ARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPA 264

  Fly   485 AMQKS----------GACPCAL 496
            |||.:          |.| |.|
  Fly   265 AMQHNSSSNSNSFYCGIC-CML 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 52/85 (61%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 269..272 CDD:409353 2/2 (100%)
Ig strand E 304..308 CDD:409353 3/3 (100%)
Ig strand F 318..323 CDD:409353 3/4 (75%)
IG_like <441..477 CDD:214653 20/35 (57%)
dpr1NP_995908.2 Ig 53..138 CDD:472250 50/85 (59%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 2/8 (25%)
CDR1 77..83 CDD:409355 2/5 (40%)
Ig strand C 84..90 CDD:409355 4/5 (80%)
CDR2 93..109 CDD:409355 11/15 (73%)
Ig strand D 109..114 CDD:409355 3/4 (75%)
FR3 110..147 CDD:409355 21/36 (58%)
Ig strand E 119..125 CDD:409355 3/5 (60%)
Ig strand F 133..148 CDD:409355 12/14 (86%)
CDR3 148..160 CDD:409355 4/15 (27%)
IG_like 163..257 CDD:214653 45/125 (36%)
Ig strand B 174..178 CDD:409355 2/3 (67%)
Ig strand C 189..193 CDD:409355 1/3 (33%)
Ig strand E 226..230 CDD:409355 3/3 (100%)
Ig strand F 240..244 CDD:409355 3/3 (100%)

Return to query results.
Submit another query.