DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and Ncam1

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_038936733.1 Gene:Ncam1 / 24586 RGDID:67378 Length:1136 Species:Rattus norvegicus


Alignment Length:200 Identity:44/200 - (22%)
Similarity:76/200 - (38%) Gaps:37/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PRAAKQICNINLCGFLRRSGADDVDVIEPRSPGHAADVDVAAAAAGATTSVAATAAAAAAATTRA 97
            |.:|....|:: ...|...||    |:.|.:|          |:||.|:.|.||:..:...|...
  Rat   922 PTSAPSANNLS-STVLANQGA----VLSPSTP----------ASAGETSKVPATSKPSPTPTPTP 971

  Fly    98 AATTRAVIIIMALVVSIMQQQQQSLLWPFCNGLAAAAASTGQPDDSGDGPTLSTFLSSSQSQSPS 162
            |.....:..:.|......|.:|::   |...||        .|:.:..|...:...:::...||.
  Rat   972 AGAASPLAAVAAPATEAPQAKQEA---PSTKGL--------DPEPTQPGTVKNPTEAATAPASPK 1025

  Fly   163 PPAASASASSPSSFSSFAVAHGPQTEATNHTFKSLAFLDASFGSDLFAQTDAKRERSGAADEESQ 227
            ..|.|.|.::||        .|...:.....||:   .|.....|:||...:....:||:.:.|:
  Rat  1026 SKAPSVSTTNPS--------QGEDLKMDEGNFKT---PDIDLAKDVFAALGSPAPATGASGQASE 1079

  Fly   228 DADTS 232
            .|.::
  Rat  1080 LAPST 1084

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845
IG_like 243..329 CDD:214653
Ig 350..464 CDD:299845
IG_like <441..477 CDD:214653
Ncam1XP_038936733.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand B 37..41 CDD:409451
Ig strand C 51..55 CDD:409451
Ig strand E 79..83 CDD:409451
Ig strand F 93..98 CDD:409451
Ig strand G 107..110 CDD:409451
IG_like 124..190 CDD:214653
Ig strand B 135..139 CDD:409353
Ig strand C 148..152 CDD:409353
Ig strand E 172..176 CDD:409353
Ig strand F 186..191 CDD:409353
IgI_3_NCAM-1 211..308 CDD:143207
Ig strand B 231..235 CDD:143207
Ig strand C 244..248 CDD:143207
Ig strand E 271..275 CDD:143207
Ig strand F 285..290 CDD:143207
Ig strand G 298..301 CDD:143207
IgI_NCAM-1 307..413 CDD:143277
Ig strand B 326..330 CDD:143277
Ig strand C 339..343 CDD:143277
Ig strand E 379..383 CDD:143277
Ig strand F 393..398 CDD:143277
Ig strand G 406..409 CDD:143277
Ig_3 422..494 CDD:404760
Ig strand B 433..437 CDD:409353
Ig strand C 446..450 CDD:409353
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
FN3 509..606 CDD:238020
fn3 619..701 CDD:394996
Herpes_BLLF1 <842..1133 CDD:282904 44/199 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.