DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and VSIG2

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_055127.2 Gene:VSIG2 / 23584 HGNCID:17149 Length:327 Species:Homo sapiens


Alignment Length:231 Identity:47/231 - (20%)
Similarity:77/231 - (33%) Gaps:77/231 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 TVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKM--SMAFQLNIIEISPD 343
            |||.||      .::|:...|             |:|.|.||||..|..  :....:|:..:.|.
Human   100 TVGVAT------LKLTDVHPS-------------DTGTYLCQVNNPPDFYTNGLGLINLTVLVPP 145

  Fly   344 AKAVISGPPDLHFKAGSAIILNCLVQQPSVKDIGPIY-WYRGEHMITPFDADDGQPEIPAGRGEH 407
            :..:.|.....  ..|.:..|.|...:.:.|   |:| |.|.....||                 
Human   146 SNPLCSQSGQT--SVGGSTALRCSSSEGAPK---PVYNWVRLGTFPTP----------------- 188

  Fly   408 PQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSAS 472
                    ||.                   |.:.|.:..:|.::|...|.:|.|.|..|....::
Human   189 --------SPG-------------------SMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSA 226

  Fly   473 VLVHVINDENPAAMQKSGACPCALGPLQLLLHLLLL 508
            .....::...|:..:.:||.      :.:||.:|||
Human   227 SCELTLSVTEPSQGRVAGAL------IGVLLGVLLL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 15/47 (32%)
Ig strand B 255..259 CDD:409353
Ig strand C 269..272 CDD:409353
Ig strand E 304..308 CDD:409353 0/3 (0%)
Ig strand F 318..323 CDD:409353 2/4 (50%)
IG_like <441..477 CDD:214653 8/35 (23%)
VSIG2NP_055127.2 V-set 31..142 CDD:462230 16/60 (27%)
Ig 152..232 CDD:472250 21/128 (16%)
Ig strand B 162..166 CDD:409353 1/3 (33%)
Ig strand C 176..180 CDD:409353 1/3 (33%)
Ig strand E 200..204 CDD:409353 1/3 (33%)
Ig strand F 214..219 CDD:409353 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.