DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and Iglon5

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:323 Identity:80/323 - (24%)
Similarity:121/323 - (37%) Gaps:78/323 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SQSLPIFDFGMPR-NITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQV 295
            ||||   :|..|. |.|...| ..|.:.|.:|. |...|:|:.:.  :||..|...:|||.|.::
Mouse    30 SQSL---EFSSPADNYTVCEG-DNATLSCFIDE-HVTRVAWLNRS--NILYAGNDRWTSDPRVRL 87

  Fly   296 TESKDSREWTLHVKAPLAKDSGIYECQVNT--EPKMSMAFQLNIIEISPDAKAVISGPPDLHFKA 358
            . .....|:::.:......|.|:|.|...|  :|..:   |:.:|...|.....||.|  :....
Mouse    88 L-INTPEEFSILITQVGLGDEGLYTCSFQTRHQPYTT---QVYLIVHVPARIVNISSP--VAVNE 146

  Fly   359 GSAIILNCLV---QQPSV--KDIGPIYWYRGEHMITPFDADDGQPEIPAGRGE------------ 406
            |..:.|.||.   .:|:|  :.:...:...|| ::...|...||    ||..|            
Mouse   147 GGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGE-ILEISDIQRGQ----AGEYECVTHNGVNSAPD 206

  Fly   407 ---------HPQGIPEDTSPNDIMSE-------------VDLQMEFATRIAMESQLGDTLK---- 445
                     :|..|.:.||....:..             .|.|.....|: :.|...:.||    
Mouse   207 SRRVLVTVNYPPTITDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRL-LSSGSAEGLKVQTE 270

  Fly   446 ---SRLRISNAQTTDTGNYTCQPTT---ASSASVLVHVINDENPAAMQKSGACPCALGPLQLL 502
               |.|..:|......|||||:...   |||||:.:     ..|.:::.|  .|...|||.||
Mouse   271 RTRSMLLFANVSARHYGNYTCRAANRLGASSASMRL-----LRPGSLENS--APRPPGPLTLL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 24/89 (27%)
IG_like 243..329 CDD:214653 24/88 (27%)
Ig 350..464 CDD:299845 32/159 (20%)
IG_like <441..477 CDD:214653 15/45 (33%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 24/95 (25%)
Ig strand A' 41..46 CDD:409353 2/4 (50%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 1/4 (25%)
FR2 61..68 CDD:409353 2/6 (33%)
Ig strand C 61..67 CDD:409353 2/5 (40%)
CDR2 69..79 CDD:409353 3/11 (27%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 9/35 (26%)
Ig strand D 84..91 CDD:409353 1/7 (14%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 2/11 (18%)
FR4 122..129 CDD:409353 1/9 (11%)
Ig strand A 132..137 CDD:409353 1/4 (25%)
Ig_3 134..199 CDD:404760 17/71 (24%)
Ig strand A' 140..145 CDD:409353 1/6 (17%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 1/5 (20%)
Ig strand F 191..199 CDD:409353 2/7 (29%)
Ig_3 217..295 CDD:404760 18/78 (23%)
putative Ig strand A 218..224 CDD:409353 1/5 (20%)
Ig strand B 234..238 CDD:409353 0/3 (0%)
Ig strand C 247..251 CDD:409353 2/3 (67%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 4/4 (100%)
Ig strand G 301..304 CDD:409353 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.