DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and zig-2

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:254 Identity:45/254 - (17%)
Similarity:79/254 - (31%) Gaps:89/254 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTES 298
            |.|:..|....|.:..|...:.::.|..:.....|:.|               ..:..|.|..|:
 Worm    29 SQPLLKFTRTPNDSNVTFGEKFVLSCGANGAPLPSIYW---------------ELNGMRIQGEET 78

  Fly   299 KDSREWTL--------------HVKAP--LAKDSGIYECQV-NTEPKMSMAFQLNI------IEI 340
            .:..|..|              |.:.|  .|::||.|:|.: |...|:....::.:      ..:
 Worm    79 SNVYENILNDGKQVSNAAMVSSHYRIPCATARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCAL 143

  Fly   341 SPDAKAVISGPPDLHFK-AGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGR 404
            :.:....||...|...: :.:|:.|:|..:..:...     |::||.::|             ..
 Worm   144 NDNGAPFISMTVDFRLEISNNAVALSCRSETATEWS-----WHKGEQLLT-------------ND 190

  Fly   405 GEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTC 463
            ||..|..|.                           ||     |.|.|...:|.|.|.|
 Worm   191 GERYQMFPS---------------------------GD-----LIIRNISWSDMGEYNC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 19/103 (18%)
IG_like 243..329 CDD:214653 18/102 (18%)
Ig 350..464 CDD:299845 21/115 (18%)
IG_like <441..477 CDD:214653 9/23 (39%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 20/114 (18%)
Ig 34..121 CDD:299845 18/101 (18%)
Ig <179..232 CDD:299845 17/89 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.