DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and zig-10

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:149 Identity:41/149 - (27%)
Similarity:60/149 - (40%) Gaps:37/149 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 ADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRF 293
            |.|.:.:||             |.|.| ::|  :.....:|:|.  ||.|::    ||....|..
 Worm    30 APTERLVPI-------------GSTTA-LEC--EPYTSSNVTWY--RDKHVI----ATVEGHKNA 72

  Fly   294 QVTESK----DSR--EWTLHVKAPLAK-DSGIYECQVNTEPKMSMAFQLNII---EISPDAKAVI 348
            .:.|.|    :.|  |....|...:.| |.|.|.||...:.|....|||.|.   |||.:.|..:
 Worm    73 ILNERKPRGGEERIPEIGFLVIFDVQKEDEGNYYCQRENDSKWGEVFQLKIAYVDEISQNEKIKL 137

  Fly   349 S-GPPDLHFKAGSAIILNC 366
            . ..|.|    |.:::|:|
 Worm   138 EPNVPTL----GRSLVLHC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 23/92 (25%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 269..272 CDD:409353 1/2 (50%)
Ig strand E 304..308 CDD:409353 0/3 (0%)
Ig strand F 318..323 CDD:409353 2/4 (50%)
IG_like <441..477 CDD:214653
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 27/108 (25%)
Ig strand B 42..46 CDD:409353 1/4 (25%)
Ig strand C 53..57 CDD:409353 1/3 (33%)
Ig strand E 91..94 CDD:409353 0/2 (0%)
Ig strand F 104..109 CDD:409353 2/4 (50%)
Ig_3 134..206 CDD:464046 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.