DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and zig-4

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:227 Identity:48/227 - (21%)
Similarity:80/227 - (35%) Gaps:59/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 DLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGI------YE--CQVNTEPKMSMA 332
            ::|...| |.....|..:..:.:|      :.:.|||  :|.:      |:  |.:.:.|..::.
 Worm    23 EMHSAVV-TLANEIDTNYLTSPAK------IKIVAPL--ESALIPGGETYQLRCDIMSTPAATIH 78

  Fly   333 FQLNIIEISPDAKAVISGPPDLHFKA-----GSAIILNCLV------QQPSVKDIG--PIYWYRG 384
            ::.|        ..:|.|..:|:.:.     |.||:...:|      |.||.::.|  ....|.|
 Worm    79 WKFN--------GKLIQGSNELNVEEKLLNFGKAIVDTGIVASILTIQCPSAENSGTYSCVGYNG 135

  Fly   385 EHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGD------- 442
            ...|......:.:.|....|..| :..||.....|  |..::....||.:...:|..|       
 Worm   136 HQTIETVAEVEIEGEASGCRSNH-KSAPEIVFWTD--SRFEMTGNVATLVCRANQQVDWVWMSND 197

  Fly   443 ---------TLKSR--LRISNAQTTDTGNYTC 463
                     |:.|.  |.|.|....|.|.|||
 Worm   198 ELVKNNDKFTVLSNGDLVIKNIVWDDMGTYTC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 12/61 (20%)
IG_like 243..329 CDD:214653 12/60 (20%)
Ig 350..464 CDD:299845 34/145 (23%)
IG_like <441..477 CDD:214653 11/41 (27%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 22/109 (20%)
Ig 65..144 CDD:143165 17/86 (20%)
IG_like 176..245 CDD:214653 14/54 (26%)
Ig <193..238 CDD:299845 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.