Sequence 1: | NP_001014459.2 | Gene: | dpr3 / 3346208 | FlyBaseID: | FBgn0053516 | Length: | 522 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106679.1 | Gene: | Ncam2 / 17968 | MGIID: | 97282 | Length: | 837 | Species: | Mus musculus |
Alignment Length: | 324 | Identity: | 68/324 - (20%) |
---|---|---|---|
Similarity: | 109/324 - (33%) | Gaps: | 101/324 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 213 DAKRERSGAADEESQDADTSQSLPIFDFGMPRNITG----RTGHTEAIIKCRVDSLHDKSVSWIR 273
Fly 274 KRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQ--LN 336
Fly 337 IIEISPDAKAVISGPPDLHFKA----GSAIILNCLVQ---QPSVKDIGPIYWYRGEHMITP---- 390
Fly 391 --------------FDADDG-----------------------QPEIPAGRGE------------ 406
Fly 407 --HPQGIPEDTSPNDI----MSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQ 464 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr3 | NP_001014459.2 | Ig | 243..330 | CDD:299845 | 22/90 (24%) |
IG_like | 243..329 | CDD:214653 | 22/89 (25%) | ||
Ig | 350..464 | CDD:299845 | 33/179 (18%) | ||
IG_like | <441..477 | CDD:214653 | 8/24 (33%) | ||
Ncam2 | NP_001106679.1 | Ig1_NCAM-2 | 21..112 | CDD:143274 | 7/24 (29%) |
I-set | 22..111 | CDD:254352 | 7/23 (30%) | ||
I-set | 117..193 | CDD:254352 | 22/88 (25%) | ||
IGc2 | 128..189 | CDD:197706 | 20/73 (27%) | ||
Ig | 208..301 | CDD:299845 | 14/103 (14%) | ||
I-set | 215..298 | CDD:254352 | 11/88 (13%) | ||
Ig | 300..397 | CDD:299845 | 22/87 (25%) | ||
IG_like | 308..395 | CDD:214653 | 19/79 (24%) | ||
IG_like | 413..491 | CDD:214653 | |||
IGc2 | 414..482 | CDD:197706 | |||
FN3 | 496..588 | CDD:238020 | |||
fn3 | 594..678 | CDD:278470 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 764..810 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |