DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and Ncam2

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:324 Identity:68/324 - (20%)
Similarity:109/324 - (33%) Gaps:101/324 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 DAKRERSGAADEESQDADTSQSLPIFDFGMPRNITG----RTGHTEAIIKCRVDSLHDKSVSWIR 273
            ||...|..|.|.:.|..:.:..|.|:.....|.:..    :.|. :|.:.|||.|....:|||:.
Mouse    87 DAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSPQEFKQGE-DAEVVCRVSSSPAPAVSWLY 150

  Fly   274 KRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQ--LN 336
            ..:       ..|...|.||.|..:.:     |.:......|.|||.|:...|.:..:.|:  :.
Mouse   151 HNE-------EVTTIPDNRFAVLANNN-----LQILNINKSDEGIYRCEGRVEARGEIDFRDIIV 203

  Fly   337 IIEISPDAKAVISGPPDLHFKA----GSAIILNCLVQ---QPSVKDIGPIYWYRGEHMITP---- 390
            |:.:.|   |::.  |...|.|    |..:.|.|...   .|::.      |:|...:|..    
Mouse   204 IVNVPP---AIMM--PQKSFNATAERGEEMTLTCKASGSPDPTIS------WFRNGKLIEENEKY 257

  Fly   391 --------------FDADDG-----------------------QPEIPAGRGE------------ 406
                          .:.|.|                       ||.|...:.|            
Mouse   258 ILKGSNTELTVRNIINKDGGSYVCKATNKAGEDQKQAFLQVFVQPHILQLKNETTSENGHVTLVC 322

  Fly   407 --HPQGIPEDTSPNDI----MSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQ 464
              ..:.:||.|....|    .||.|...:  .||.::.|.|   :|.|.|.:.:.:|:|.|.|:
Mouse   323 EAEGEPVPEITWKRAIDGVMFSEGDKSPD--GRIEVKGQHG---RSSLHIRDVKLSDSGRYDCE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 22/90 (24%)
IG_like 243..329 CDD:214653 22/89 (25%)
Ig 350..464 CDD:299845 33/179 (18%)
IG_like <441..477 CDD:214653 8/24 (33%)
Ncam2NP_001106679.1 Ig1_NCAM-2 21..112 CDD:143274 7/24 (29%)
I-set 22..111 CDD:254352 7/23 (30%)
I-set 117..193 CDD:254352 22/88 (25%)
IGc2 128..189 CDD:197706 20/73 (27%)
Ig 208..301 CDD:299845 14/103 (14%)
I-set 215..298 CDD:254352 11/88 (13%)
Ig 300..397 CDD:299845 22/87 (25%)
IG_like 308..395 CDD:214653 19/79 (24%)
IG_like 413..491 CDD:214653
IGc2 414..482 CDD:197706
FN3 496..588 CDD:238020
fn3 594..678 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.