DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and nitr1d

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_938163.1 Gene:nitr1d / 170990 ZFINID:ZDB-GENE-020225-11 Length:324 Species:Danio rerio


Alignment Length:181 Identity:43/181 - (23%)
Similarity:67/181 - (37%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 QTEATNHTFKSLAFLDASFGSDLFAQTDAKRERSGAA-------DEESQDADTSQSLPIFDFGMP 243
            |..:.||.|:.....:.:.|...|..|..|.:.|.:|       ..::....:...|.:.|....
Zfish    71 QKPSWNHNFEKTNRFNVNKGDFYFNLTIVKTKPSDSATYYCVVSSYQATGMGSGTRLLVRDEAAD 135

  Fly   244 RNITGRTGHTEAI-------IKCRV---DSLHDKSVSWIRKRDLHILTVGTA---TYTSDKR--- 292
            ||.|......:|:       ::|.:   ....|..|.|.::      :.|.:   .||..:|   
Zfish   136 RNTTLHQSLIDAVDPGDSVHLQCSIFTESCAGDHRVYWFKQ------SSGDSEGVLYTKGERNGR 194

  Fly   293 -FQVTESK-DSREWTLHVKAPLAKDSGIYECQVNT--EPKMSMAFQLNIIE 339
             ...|||: .|..::||.......|||||.|.|..  |..:....||||.|
Zfish   195 CKNSTESQTQSCVYSLHKNNISRSDSGIYYCAVAACGEILLGRGTQLNIKE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 26/106 (25%)
IG_like 243..329 CDD:214653 26/105 (25%)
Ig 350..464 CDD:299845
IG_like <441..477 CDD:214653
nitr1dNP_938163.1 Ig 35..130 CDD:299845 11/58 (19%)
IG_like 59..129 CDD:214653 11/57 (19%)
IG_like 148..227 CDD:214653 20/84 (24%)
V-set 150..243 CDD:284989 24/98 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.