DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and LOC101885129

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_021333804.1 Gene:LOC101885129 / 101885129 -ID:- Length:654 Species:Danio rerio


Alignment Length:389 Identity:77/389 - (19%)
Similarity:110/389 - (28%) Gaps:163/389 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 TLSTFLSSSQSQSPSPPAASASASSPSSFSSFAVAHGPQTE-ATNHTFKSLAFLDASFGSDLFAQ 211
            |.:||:..             ||::|||.|     |...|: :..||           ||     
Zfish     5 TTNTFIDK-------------SAATPSSLS-----HPNNTKLSVPHT-----------GS----- 35

  Fly   212 TDAKRERSGAADEESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIR--- 273
                          |:..||...|.|...|...|.|           |.:.:....||.||:   
Zfish    36 --------------SETTDTQNYLKIVQAGDTVNFT-----------CSLSNEIRSSVVWIKQSV 75

  Fly   274 -KRDLHILTVGTAT-------YTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMS 330
             |:.|.:::.....       :....||.||  ||...:.|.:......||..|.|       ::
Zfish    76 GKKPLPVVSSFQIVDHRFENDFNKQNRFFVT--KDDVSFNLSITNTEVSDSATYYC-------IT 131

  Fly   331 MAFQLNIIEISPDAKAVISGPPDLHFKAGSAII---------------LNCLVQQPSVKDIGPIY 380
            .|:..           ......||..|||...|               |.|.:...|..:...:|
Zfish   132 YAYHF-----------TFGNSTDLIVKAGGVNIESEHERSASESPSEDLQCSIISQSCAEEHRVY 185

  Fly   381 WYRGEHMITPFDADDGQPEIPAGRGEHPQGI----------------PEDTSPNDIMS----EVD 425
            |:|..                  .||.|.|:                |..|:...|.|    :.|
Zfish   186 WFRQR------------------SGESPPGVIYTQDSRSAQCENSSDPNSTAHKCIYSLPKTDED 232

  Fly   426 LQMEFATRIAMESQL--GDTLKSRLR----------------ISNAQTTDTGNYTCQPTTASSA 471
            ..:.:.. :|...|:  ||..|..||                |.:....|:.|..|...|.|.|
Zfish   233 PAIYYCA-VAACGQILFGDGRKFCLRGPDSATDRNTTLHQSLIDSVDPGDSVNLQCSIFTESCA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 20/97 (21%)
IG_like 243..329 CDD:214653 20/96 (21%)
Ig 350..464 CDD:299845 31/166 (19%)
IG_like <441..477 CDD:214653 12/47 (26%)
LOC101885129XP_021333804.1 Ig 47..146 CDD:325142 25/129 (19%)
Ig 161..253 CDD:325142 19/110 (17%)
V-set 354..454 CDD:311561
V-set 470..566 CDD:311561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.