DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and LOC100909964

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_008767726.1 Gene:LOC100909964 / 100909964 RGDID:6500592 Length:308 Species:Rattus norvegicus


Alignment Length:316 Identity:60/316 - (18%)
Similarity:101/316 - (31%) Gaps:122/316 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 ERSGAADEESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKS-VSWIR----KRD 276
            |..||..:|.:.....:.:.::|.|            ..|:.|.|.||.... ..|.:    .|.
  Rat    22 ELKGADMKELKVIQPQKLVSVYDGG------------SVILNCTVTSLTPVGPTRWFKGEGQNRQ 74

  Fly   277 LHILTVGTATYTSDKRFQVTE-----SKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLN 336
            |      ..::..|...::|.     .:::.::::.:...:..|:|.|.|         :.||..
  Rat    75 L------IYSFRGDYFPRITNIADVTKRNNTDFSIRISNIMLADAGTYYC---------VKFQKG 124

  Fly   337 IIEISPDAKAVISGPPDL-------------------HFKAGSAIILNCLVQQPSVKDIGPIYWY 382
            .:|  ||.:....|..:|                   ...||.::.|||.|  .|:..:|||.|:
  Rat   125 TVE--PDIEIQSGGGTELFVYGADMKKLKVVQPEKLISVDAGESVTLNCTV--TSIIPMGPIKWF 185

  Fly   383 RG----EHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDT 443
            ||    .|:|..|..           |..|:                     .|.:: :|...:.
  Rat   186 RGAQHSRHLIFNFTG-----------GYFPR---------------------VTNVS-DSSKRNN 217

  Fly   444 LKSRLRISNAQTTDTGNYTC-------------------------QPTTASSASVL 474
            |...:||||....|.|.|.|                         :|.|:..|.:|
  Rat   218 LDFSIRISNVMPADAGTYYCVKFQKELLETDIEIQSGGGTELLVFEPKTSGIAKIL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 14/96 (15%)
IG_like 243..329 CDD:214653 14/95 (15%)
Ig 350..464 CDD:299845 31/161 (19%)
IG_like <441..477 CDD:214653 13/59 (22%)
LOC100909964XP_008767726.1 V-set 35..142 CDD:284989 23/135 (17%)
IG_like 40..142 CDD:214653 23/130 (18%)
V-set 154..261 CDD:284989 29/141 (21%)
IG_like 159..238 CDD:214653 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.