DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and ntm

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:365 Identity:85/365 - (23%)
Similarity:144/365 - (39%) Gaps:106/365 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 QSLPI--FDFGMPR---NITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKR 292
            |.:|:  .|.|.|:   |:|.|.|.: ||::|.||:...: |:|:.:..  ||..|...::.|.|
 Frog    28 QGVPVRSGDAGFPKAMDNVTVRQGDS-AILRCTVDNRVTR-VAWLNRST--ILYTGNDKWSIDPR 88

  Fly   293 FQVTESKDSREWTLHVKAPLAKDSGIYECQVNTE--PKMSMAFQLNIIEISPDAKAVISGPPDLH 355
            ..:..:..| ::::.::.....|.|.|.|.|.|:  ||.|....  |:::.|   .::.....:.
 Frog    89 VVLLANTKS-QYSIEIQNVDIYDEGPYTCSVQTDNHPKTSRVHL--IVQVPP---RIVDISSSIA 147

  Fly   356 FKAGSAIILNCLVQ---QPSVKDIGPIYWYRGEHMITP----FDADDGQPEIPAGRGEHPQGIPE 413
            ...||.:.|.|:..   :|.|.      |    ..::|    |.::|...|| .|......||.|
 Frog   148 VNEGSNVSLICIANGRPEPVVN------W----RYLSPKARGFVSEDEYLEI-TGITREQSGIYE 201

  Fly   414 DTSPNDI----MSEVDLQMEFATRIAMESQLGDTLKSR--------------------------- 447
            .::.||:    :..|.|.:.:...|.....:|..|..|                           
 Frog   202 CSASNDVSAPDVRRVKLTVNYPPYILDAQNIGAPLGHRGILQCEASAVPAADFFWYKEDKRLSDS 266

  Fly   448 ---LRISNAQT-----------TDTGNYTCQPTTA---SSASVLVH---------VINDENPAAM 486
               :::.|.:|           .|.|||||.....   |:||:::.         ::.:|:.||:
 Frog   267 WRGVKVENRETISRVTFLNVSEQDYGNYTCMAKNLLGHSNASIILFELFQSTSSPLLQEESTAAL 331

  Fly   487 Q-----------KSGACPCAL-GPLQLLLHLLLLPELLLL 514
            .           .||:..|:. .||.:|  |||||..|||
 Frog   332 TPLKGPGAVHDGNSGSTQCSFCAPLLIL--LLLLPFSLLL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 26/91 (29%)
IG_like 243..329 CDD:214653 25/90 (28%)
Ig 350..464 CDD:299845 31/165 (19%)
IG_like <441..477 CDD:214653 14/88 (16%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 26/94 (28%)
IG_like 45..133 CDD:214653 26/94 (28%)
IG_like 143..220 CDD:214653 20/87 (23%)
IGc2 150..209 CDD:197706 18/69 (26%)
ig 227..311 CDD:278476 14/83 (17%)
IG_like 230..311 CDD:214653 14/80 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.