DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and Sirpd

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_017446697.1 Gene:Sirpd / 100360722 RGDID:2321536 Length:308 Species:Rattus norvegicus


Alignment Length:238 Identity:52/238 - (21%)
Similarity:80/238 - (33%) Gaps:81/238 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 IKCRVDSLHDKS-VSWIR--KRDLHILTVGTATYTSDKRFQVTESKDSR-----EWTLHVKAPLA 313
            :.|.|.||.... :.|.|  ....|::...|..:.|    ::|.:.|:.     ::::|:.....
  Rat    50 LNCTVTSLTPVGPIKWFRGVGHSRHLIYYFTGYHFS----RITNASDATKRGNLDFSIHISNVTP 110

  Fly   314 KDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLH-------------------FKAG 359
            .|:|.|.|         :.||..|:|  ||.:....|..:|.                   ..||
  Rat   111 ADAGTYYC---------VKFQKGIVE--PDIEIQSGGGTELSVFVADMKELKVFQPKKSVCVDAG 164

  Fly   360 SAIILNCLVQQPSVKDIGPIYWYRG----EHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDI 420
            .::.|||.|  .|:..:|||.||||    .|:|..|..               ...|..|:.:|.
  Rat   165 GSVTLNCTV--TSLTPVGPIKWYRGVGHNRHLIYNFTG---------------YRFPRVTNASDA 212

  Fly   421 MSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTC 463
            ....:|...                  :.|||....|.|.|.|
  Rat   213 TKRGNLDFS------------------IHISNVTPADAGTYYC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 16/80 (20%)
IG_like 243..329 CDD:214653 16/79 (20%)
Ig 350..464 CDD:299845 30/137 (22%)
IG_like <441..477 CDD:214653 7/23 (30%)
SirpdXP_017446697.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.