Sequence 1: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038964701.1 | Gene: | Chl1 / 89828 | RGDID: | 620122 | Length: | 1224 | Species: | Rattus norvegicus |
Alignment Length: | 419 | Identity: | 95/419 - (22%) |
---|---|---|---|
Similarity: | 149/419 - (35%) | Gaps: | 113/419 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 DSTSSGG-SGTGGAPPDRPP---TPPLSLQPSTPSITHFVNESFIIFC-----QTVQKDIDTKWR 81
Fly 82 D-----PRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFL 141
Fly 142 ASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNG 206
Fly 207 LYIRNVSQAD-----AGEYTCRAMRITPTF---SDSDQITILLRIQHKPHWFFNETLPVQYAYVG 263
Fly 264 GAVNLSCDAMGEPPPSFTW-----LHNNKGIVGFNHRIFVADYGATLQLQMKNASQFGDYKCKVA 323
Fly 324 NPLGM--------LERVIKLRPGPKPLGPR--RFQLKKLY------------------------- 353
Fly 354 TNGFE-----LDIQTPRMSNVSDEMQ-IY 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33543 | NP_001014458.3 | IGc2 | 165..224 | CDD:197706 | 15/63 (24%) |
IG_like | 256..336 | CDD:214653 | 18/92 (20%) | ||
IGc2 | 263..327 | CDD:197706 | 15/68 (22%) | ||
FN3 | 341..445 | CDD:238020 | 15/69 (22%) | ||
Chl1 | XP_038964701.1 | Ig | 34..125 | CDD:416386 | |
Ig strand A | 34..38 | CDD:409353 | |||
Ig strand A' | 43..47 | CDD:409353 | |||
Ig strand B | 52..59 | CDD:409353 | |||
Ig strand C | 65..70 | CDD:409353 | |||
Ig strand C' | 73..75 | CDD:409353 | |||
Ig strand D | 81..84 | CDD:409353 | |||
Ig strand E | 89..93 | CDD:409353 | |||
Ig strand F | 104..112 | CDD:409353 | |||
Ig strand G | 115..125 | CDD:409353 | |||
IgI_2_L1-CAM_like | 134..224 | CDD:409432 | |||
Ig strand B | 148..152 | CDD:409432 | |||
Ig strand C | 162..166 | CDD:409432 | |||
Ig strand E | 185..189 | CDD:409432 | |||
Ig strand F | 200..205 | CDD:409432 | |||
Ig strand G | 216..219 | CDD:409432 | |||
Ig | 261..343 | CDD:416386 | 22/105 (21%) | ||
Ig strand B | 273..277 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 286..290 | CDD:409353 | 1/7 (14%) | ||
Ig strand E | 308..312 | CDD:409353 | 3/8 (38%) | ||
Ig strand F | 322..327 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 335..338 | CDD:409353 | 0/2 (0%) | ||
Ig4_L1-NrCAM_like | 347..434 | CDD:409367 | 21/91 (23%) | ||
Ig strand B | 363..367 | CDD:409367 | 0/3 (0%) | ||
Ig strand C | 376..380 | CDD:409367 | 0/3 (0%) | ||
Ig strand E | 399..403 | CDD:409367 | 1/3 (33%) | ||
Ig strand F | 413..418 | CDD:409367 | 2/4 (50%) | ||
Ig strand G | 426..429 | CDD:409367 | 0/2 (0%) | ||
Ig | 447..524 | CDD:416386 | 19/89 (21%) | ||
Ig strand A' | 447..451 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 454..463 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 469..474 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 477..480 | CDD:409353 | 0/2 (0%) | ||
Ig strand D | 485..490 | CDD:409353 | 0/4 (0%) | ||
Ig strand E | 491..498 | CDD:409353 | 2/6 (33%) | ||
Ig strand F | 505..513 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 516..524 | CDD:409353 | 1/7 (14%) | ||
Ig | 528..627 | CDD:416386 | 20/79 (25%) | ||
Ig strand A | 528..534 | CDD:409353 | 2/5 (40%) | ||
Ig strand A' | 537..542 | CDD:409353 | 3/6 (50%) | ||
Ig strand B | 545..553 | CDD:409353 | 2/7 (29%) | ||
Ig strand C | 564..568 | CDD:409353 | 0/3 (0%) | ||
Ig strand D | 583..586 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 589..593 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 602..609 | CDD:409353 | 2/3 (67%) | ||
Ig strand G | 616..620 | CDD:409353 | |||
FN3 | 627..716 | CDD:238020 | |||
fn3 | 730..811 | CDD:394996 | |||
FN3 | 832..926 | CDD:238020 | |||
FN3 | 931..1026 | CDD:238020 | |||
Bravo_FIGEY | 1120..1201 | CDD:404722 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12231 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |