DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and KIRREL3

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:312 Identity:75/312 - (24%)
Similarity:120/312 - (38%) Gaps:63/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PPTPPLSLQPSTPSITHFVNESFIIF-CQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLL 105
            ||...||::|..     .:.::.:.| |........|::| ..|||..:...|.|:   :||...
Human   255 PPLVNLSVEPQP-----VLEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVY---RTTVDY 311

  Fly   106 ALVFEHIALEDRGNWTCEVN---GNRNGNRNVNVEREFLASFELLVNQKISFG--KTEQVQS--V 163
            ....|.:        :|||.   |:.|.:|.|:|                .||  .|.:.||  |
Human   312 TYFSEPV--------SCEVTNALGSTNLSRTVDV----------------YFGPRMTTEPQSLLV 352

  Fly   164 REGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRIT 228
            ..|.||:.:|...|.|:..:.|:..|..:...|       ...|.:::|.|.|||:|.|||  :.
Human   353 DLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSN-------EKTLTLKSVRQEDAGKYVCRA--VV 408

  Fly   229 PTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPP---SFTWLHN--NKG 288
            |.....:: .:.|.:...|.....:|   |:|..|....:.|.....|||   :::|..|  ..|
Human   409 PRVGAGER-EVTLTVNGPPIISSTQT---QHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESG 469

  Fly   289 IVG-FNHRIFVADYGATLQLQMKN--ASQFGD-YKCKVANPLGMLERVIKLR 336
            ..| :.......:.|....|.:.|  .:.|.. |.|...|..|....:|:|:
Human   470 TSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLK 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/58 (29%)
IG_like 256..336 CDD:214653 20/88 (23%)
IGc2 263..327 CDD:197706 16/72 (22%)
FN3 341..445 CDD:238020
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352
Ig2_KIRREL3-like 171..252 CDD:143236
Ig_2 260..337 CDD:290606 22/92 (24%)
I-set 341..422 CDD:254352 25/90 (28%)
IGc2 355..406 CDD:197706 17/57 (30%)
Ig5_KIRREL3 424..521 CDD:143306 22/99 (22%)
IG_like 432..521 CDD:214653 21/91 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.