DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and ntm

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_021334871.1 Gene:ntm / 678534 ZFINID:ZDB-GENE-060421-6020 Length:380 Species:Danio rerio


Alignment Length:330 Identity:71/330 - (21%)
Similarity:121/330 - (36%) Gaps:63/330 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ITH--FVNESFIIFCQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRG 118
            :||  ::|.|.|::..      :.||. ||          ||.:...:.....:..|.:.:.|.|
Zfish    63 VTHTAWLNRSSILYAG------EDKWSVDP----------RVSLVTLSQEEFTIKIEDVDVTDEG 111

  Fly   119 NWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEV 183
            .:.|.|..:         .|....|..::|..........:...|.||.:..:.|...|.|.|.:
Zfish   112 QYICAVQTS---------SRPRTTSVHIIVQVPPKIVNLSRDLVVNEGSNVTLMCLANGKPEPAI 167

  Fly   184 SWLYNGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPH 248
            .|.......::::|.     |..|.|..:|:..||.|.|.|......    |..|:.|.:.:.|.
Zfish   168 VWRMKSPSDDSLSSD-----SEVLDIPFISRYRAGVYECTAANDIAV----DTQTVELTVNYAPS 223

  Fly   249 WFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNAS 313
            ......:.|.   :|....|.|:|...|...|.|..:::.|......|.:...||..:|...|.|
Zfish   224 VSDGRDVGVT---LGQRGVLQCEADAVPEADFEWYRDDRRIFNGLDGIEIEAAGALSRLTFFNVS 285

  Fly   314 Q--FGDYKCKVANPLG------MLERVIKLRPGPKPLGPRRFQLKKLYTNGFELDI------QTP 364
            :  :|:|.|...|.||      :|..:|:         |....|.::.|:...|::      |||
Zfish   286 EADYGNYTCVAINKLGSANTSFVLYEIIE---------PTSSTLLQVETSPSVLEMTSSDLEQTP 341

  Fly   365 RMSNV 369
            ..:::
Zfish   342 LQNDL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 16/58 (28%)
IG_like 256..336 CDD:214653 23/87 (26%)
IGc2 263..327 CDD:197706 18/65 (28%)
FN3 341..445 CDD:238020 7/35 (20%)
ntmXP_021334871.1 Ig 44..132 CDD:325142 18/93 (19%)
Ig_3 135..205 CDD:316449 18/74 (24%)
I-set 228..309 CDD:333254 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.