DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Negr1

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_038958934.1 Gene:Negr1 / 59318 RGDID:708416 Length:362 Species:Rattus norvegicus


Alignment Length:358 Identity:76/358 - (21%)
Similarity:124/358 - (34%) Gaps:112/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIALCSLL---------------LLLLSQNAAILG-QLDSTSSGGSGTGGAPPDRPPTPPLSLQP 52
            |::|||.|               :|:...:.|:|. .|:..:|.|:                   
  Rat    19 LLSLCSCLPAGQSVDFPWAAVDNMLVRKGDTAVLRCYLEDGASKGA------------------- 64

  Fly    53 STPSITHFVNESFIIFCQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLLALVFEHIALED 116
                   ::|.|.|||..      ..||. ||          ||.|........:|..:::.:.|
  Rat    65 -------WLNRSSIIFAG------GDKWSVDP----------RVSISTLNKRDYSLQIQNVDVTD 106

  Fly   117 RGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAP 181
            .|.:||.|. .::..|.:.|        .|.|.............::.||.:..:.|...|.|.|
  Rat   107 DGPYTCSVQ-TQHTPRTMQV--------HLTVQVPPKIYDISNDMTINEGTNVTLTCLATGKPEP 162

  Fly   182 EVSWLY---------NGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQI 237
            .:||.:         ||:|::               |..:::..||||.|.|.. ..:|.|..::
  Rat   163 AISWRHISPSAKPFENGQYLD---------------IYGITRDQAGEYECSAEN-DVSFPDVKKV 211

  Fly   238 TILLRIQHKPHWFFNETLPVQYAYVGGAVN------LSCDAMGEPPPSFTWLHNNKGIVGFNHRI 296
            .:::..           .|.......|.|.      :.|:..|.|||:|.|....|.:......|
  Rat   212 RVVVNF-----------APTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKRLFNGQQGI 265

  Fly   297 FVADYGATLQLQMKNASQ--FGDYKCKVANPLG 327
            .:.::.....|.:.|.:|  ||:|.|..||.||
  Rat   266 IIQNFSTRSILTVTNVTQEHFGNYTCVAANKLG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/67 (25%)
IG_like 256..336 CDD:214653 23/80 (29%)
IGc2 263..327 CDD:197706 20/71 (28%)
FN3 341..445 CDD:238020
Negr1XP_038958934.1 FR1 38..55 CDD:409353 3/16 (19%)
Ig strand A' 40..46 CDD:409353 1/5 (20%)
IG_like 41..129 CDD:214653 27/138 (20%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 1/3 (33%)
FR2 61..68 CDD:409353 2/32 (6%)
Ig strand C 61..67 CDD:409353 2/31 (6%)
CDR2 69..79 CDD:409353 4/15 (27%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 10/44 (23%)
Ig strand D 84..91 CDD:409353 3/6 (50%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 0/3 (0%)
Ig strand G 120..129 CDD:409353 3/16 (19%)
FR4 122..129 CDD:409353 2/14 (14%)
Ig strand A' 139..144 CDD:409353 0/4 (0%)
IGc2 146..204 CDD:197706 18/73 (25%)
Ig strand B 150..157 CDD:409353 1/6 (17%)
Ig strand C 163..168 CDD:409353 2/4 (50%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand E 180..186 CDD:409353 2/20 (10%)
Ig strand F 193..200 CDD:409353 4/6 (67%)
Ig strand G 207..215 CDD:409353 1/7 (14%)
Ig_3 219..295 CDD:404760 19/75 (25%)
putative Ig strand A 219..225 CDD:409353 1/5 (20%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.