DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and CG34353

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:399 Identity:87/399 - (21%)
Similarity:145/399 - (36%) Gaps:95/399 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DRGNWTCEVNGNRNGNRNVNVE-REFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMP 179
            |.|::.|::         ..:: ||...:.|:||..:|....|.....|::|....:.|...|.|
  Fly   156 DAGDYICQI---------ATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNP 211

  Fly   180 APEVSWLYNGEYINTVNSTKHNRLSNG--------LYIRNVSQADAGEYTCRA-MRITPTFSDSD 235
            .|.|:|           |.|:|.|.||        |.|.||.:...|.|.|.| .|:....|.. 
  Fly   212 MPNVTW-----------SRKNNILPNGEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQ- 264

  Fly   236 QITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVAD 300
               ::|.:...|.  .:...||.::..|....|.|...||..|...|..:...: ....|..:..
  Fly   265 ---VVLHVLFSPE--ISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQL-DTTERHIMET 323

  Fly   301 YGA--TLQLQMKNASQFGDYKCKVANPLGMLERVIKLRPGP------------------------ 339
            .|:  ||.::..:...||:|.|...|.||...:.::|...|                        
  Fly   324 RGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQYKDRYNISWAVD 388

  Fly   340 --KPLGPRRFQLKKLYTNGFE-----LDIQTPRMSNVSDEMQIYG-----YRV-AYMSDTEFKFS 391
              .|:...:...:|| ..|.|     :|..:...|..|...|:||     :|: :.|........
  Fly   389 SHSPIEEYKLSFRKL-PQGHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAHRIGSNMGGLSGLSG 452

  Fly   392 AGNWS-YAKQRDFSFHGGKHFIIP------HLETNTTYLMR-----------AASRNLAGLSDWS 438
            :|::| |.....:..:..::.::|      |.....:|::|           ..|||..|.||.:
  Fly   453 SGSYSGYGNVIHWGHNDWRNVVLPAVPVSHHYAQGMSYMVRGLDPDQHYEATVQSRNRYGWSDLT 517

  Fly   439 PVKVFTTAA 447
            ...||:|::
  Fly   518 NSFVFSTSS 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 20/66 (30%)
IG_like 256..336 CDD:214653 20/81 (25%)
IGc2 263..327 CDD:197706 16/65 (25%)
FN3 341..445 CDD:238020 28/132 (21%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 6/32 (19%)
Ig 103..177 CDD:143165 5/29 (17%)
IG_like 191..269 CDD:214653 25/92 (27%)
IGc2 198..258 CDD:197706 22/70 (31%)
I-set 273..360 CDD:254352 21/89 (24%)
Ig 290..359 CDD:143165 17/69 (25%)
FN3 <466..524 CDD:238020 12/57 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.