DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33543 and lrit3a

DIOPT Version :9

Sequence 1:	NP_001014458.3	Gene:	CG33543 / 3346207	FlyBaseID:	FBgn0053543	Length:	468	Species:	Drosophila melanogaster
Sequence 2:	NP_001122166.1	Gene:	lrit3a / 558559	ZFINID:	ZDB-GENE-080723-63	Length:	636	Species:	Danio rerio

Alignment Length:	89	Identity:	28/89 - (31%)
Similarity:	37/89 - (41%)	Gaps:	8/89 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   262 VGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYG-----ATLQLQMKNASQFGDYKCK 321
            :|..|.|.|||.|.|.|:..|...:..:|  |:.:.....|     :.|.|........|||:||
Zfish   265 LGSNVLLRCDANGFPTPTLLWTTADGSVV--NNTVVQESPGEGVRWSILSLHSIVFKDAGDYRCK 327

  Fly   322 VANPLGMLERVIKLR-PGPKPLGP 344
            ..|..|..|..|.|. .|.:|..|
Zfish   328 AKNVAGNAEAYITLSVDGVQPTTP 351

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33543	NP_001014458.3	IGc2	165..224	CDD:197706
		IG_like	256..336	CDD:214653	24/78 (31%)
		IGc2	263..327	CDD:197706	21/68 (31%)
		FN3	341..445	CDD:238020	2/4 (50%)
lrit3a	NP_001122166.1	LRR_8	81..141	CDD:290566
		leucine-rich repeat	83..106	CDD:275378
		LRR_4	107..145	CDD:289563
		leucine-rich repeat	107..130	CDD:275378
		LRR_8	129..>171	CDD:290566
		LRR_4	129..170	CDD:289563
		leucine-rich repeat	131..154	CDD:275378
		leucine-rich repeat	155..168	CDD:275378
		TPKR_C2	199..249	CDD:301599
		Ig	252..343	CDD:299845	25/79 (32%)
		IG_like	261..343	CDD:214653	25/79 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900