DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and sdk1a

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_009297968.1 Gene:sdk1a / 558391 ZFINID:ZDB-GENE-081104-374 Length:2245 Species:Danio rerio


Alignment Length:509 Identity:96/509 - (18%)
Similarity:162/509 - (31%) Gaps:161/509 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GSGTGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVH 96
            ||....||.| |..|.:.:.|...::...::|:                      |.|.......
Zfish   310 GSHDSEAPAD-PVAPVIVIPPRNTTVVAGISEA----------------------TLECVANARP 351

  Fly    97 IEKKTTGLLALVFEHIALE--------------------DRGNWTCEVNGNRNGNRNVNVEREFL 141
            :||     |:||:....:|                    |.|.:.||.                 
Zfish   352 VEK-----LSLVWRRNGVEVASGVGSFSRRLTIINPTSTDVGMYVCEA----------------- 394

  Fly   142 ASFELLVNQKISFGKTEQVQSVREG----------------RDAMVNCFVEGMPAPEVSWLYNGE 190
                ||::..:...:.....|:.|.                :...:.|...|:|.|::.|..:..
Zfish   395 ----LLLDSSVKPAEARAFLSITEAPYFTAEPRRKMMGEVEKSVDIQCQARGVPMPKLEWYKDAV 455

  Fly   191 YINTVNSTKHNRLSN-GLYIRNVSQADAGEYTCRAMRI-----TPTFSDSDQITILLRIQHKPHW 249
            .::.:|:.::..:|: ||.:|.:..:|||.:.|.|...     ..|:.|   :|.:......|  
Zfish   456 PLSKLNNPRYKIISSMGLQVRKLQPSDAGIFQCFARNSAGEAQVHTYLD---VTSMAPAFTAP-- 515

  Fly   250 FFNETLPVQYAYVGGAV-NLSCDAMGEPPPSFTWLHNNKGIVGFNHRI--FVADYGATLQLQMKN 311
                  |:......||| ..:|...|.|.|:..|..:.:.:...:.:|  |.......||:|...
Zfish   516 ------PLDITVTDGAVAAFTCRVSGAPKPAIVWRRDTQILASGSVQIPRFTLLESGGLQIQPVV 574

  Fly   312 ASQFGDYKCKVANPLGML--------------------ERVIKLRPGPKPLG----PR---RFQL 349
            ....|:|.|..||..|.:                    .||||........|    ||   |:..
Zfish   575 LQDTGNYTCYAANSEGAINASASLTVWSRTSISSPPTDRRVIKGTTAILECGATHDPRVGVRYVW 639

  Fly   350 KK-----LYTNGFELDIQTPRMSNVSDEM--QIYGYRVAYMSDTEFKFSAGNWSYAKQRDFSFHG 407
            ||     .::.|..:.:|...: ::|...  .|..|....:|:      |||.|...:.:.    
Zfish   640 KKDEELVSHSRGGRISLQEGSL-HISQTWSGDIGNYTCDVISE------AGNESKEARLEV---- 693

  Fly   408 GKHFIIPHLETNTTYLMRAASRNLAGLSDW-------SPVKVFTTAAGCSWSPW 454
               ..:||...|....:.|.......|| |       ||:..:......:.|||
Zfish   694 ---IELPHSPRNLQASLNANDSRSVDLS-WMRPFDGNSPLLHYVVELSENNSPW 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 15/75 (20%)
IG_like 256..336 CDD:214653 24/102 (24%)
IGc2 263..327 CDD:197706 18/66 (27%)
FN3 341..445 CDD:238020 25/124 (20%)
sdk1aXP_009297968.1 I-set 125..208 CDD:254352
Ig 125..204 CDD:299845
IG_like 222..302 CDD:214653
Ig 236..287 CDD:299845
Ig_3 322..394 CDD:290638 14/98 (14%)
I-set 323..412 CDD:254352 17/136 (13%)
I-set 416..505 CDD:254352 17/91 (19%)
Ig 436..500 CDD:299845 15/63 (24%)
I-set 510..600 CDD:254352 21/97 (22%)
Ig 527..600 CDD:299845 16/72 (22%)
I-set 605..693 CDD:254352 20/94 (21%)
Ig 610..693 CDD:299845 20/89 (22%)
FN3 697..788 CDD:238020 12/48 (25%)
fn3 800..886 CDD:278470
FN3 901..997 CDD:238020
FN3 1002..1090 CDD:238020
FN3 1100..1196 CDD:238020
FN3 1206..1301 CDD:238020
FN3 1308..1397 CDD:238020
FN3 1408..1501 CDD:238020
FN3 1507..1602 CDD:238020
FN3 1616..1722 CDD:238020
FN3 1732..1825 CDD:238020
FN3 1830..1919 CDD:238020
FN3 1931..2021 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.