DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and lrit1a

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001018174.2 Gene:lrit1a / 553943 ZFINID:ZDB-GENE-040924-5 Length:643 Species:Danio rerio


Alignment Length:338 Identity:71/338 - (21%)
Similarity:110/338 - (32%) Gaps:105/338 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 VQSVRE--GRDAMVNCFVEGMPAPEVSW-LYNGEYIN---TVNSTKHNRLSNGLYIRNVSQADAG 218
            |..||.  |.:.::.|...|:|.||::| ..:|:.:|   .:.::|...:.:.|.:..||..|.|
Zfish   258 VARVRSAVGNNVLLRCGTVGVPIPELAWRRADGKPLNGTVLLENSKEGIVWSILSVPAVSYRDTG 322

  Fly   219 EYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWL 283
            :|.|:|    ..::.|.:..|.|.|...|. ..|.||                   :|.|.....
Zfish   323 KYICKA----TNYAGSAEAVISLIINDAPK-MENPTL-------------------DPKPKLKSK 363

  Fly   284 HNNKGIVGFNHRIFVADY-------GATLQ-----------LQMKNASQFGDYKCKVANPLGMLE 330
            ..|..:........:|.|       |..|.           ::..||:. .....:.|:|.|.||
Zfish   364 KPNTMVKAAYQEKHIATYVSPTPKNGLPLSGTVSYTGPYPGMESDNAAN-SRMNTQTASPDGFLE 427

  Fly   331 RVIKLRPGPKPLGPRRFQLKKLYTNGFELDIQTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAGNW 395
            .                .|..|..|...|. |.|  ..|...:::.|       ||::.... ||
Zfish   428 T----------------NLSNLAANTSSLQ-QDP--DRVVRSVKVIG-------DTDYTVCL-NW 465

  Fly   396 S-------------YA--KQRDFS----FHGGKHFIIPHLETNTTYLMRAASRNLAGLSDWSPVK 441
            .             ||  .:||..    ..|....:|..|...|.|:.....:.|.      |.|
Zfish   466 RAPTAKNTTAFSVLYAVFGERDMRRINVSPGNNRIVIEGLVPKTKYIACVCVKGLI------PKK 524

  Fly   442 ----VFTTAAGCS 450
                :|:|.|..|
Zfish   525 EQCVIFSTDAAAS 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/64 (27%)
IG_like 256..336 CDD:214653 14/97 (14%)
IGc2 263..327 CDD:197706 11/81 (14%)
FN3 341..445 CDD:238020 25/126 (20%)
lrit1aNP_001018174.2 leucine-rich repeat 61..84 CDD:275378
LRR_8 63..119 CDD:290566
LRR_RI <77..175 CDD:238064
leucine-rich repeat 85..108 CDD:275378
LRR_8 108..167 CDD:290566
leucine-rich repeat 109..132 CDD:275378
leucine-rich repeat 133..156 CDD:275378
leucine-rich repeat 157..170 CDD:275378
LRRCT 199..243 CDD:214507
I-set 252..343 CDD:254352 24/88 (27%)
Ig 259..333 CDD:299845 20/77 (26%)
fn3 448..515 CDD:278470 14/74 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.