DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and iglon5

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:356 Identity:78/356 - (21%)
Similarity:133/356 - (37%) Gaps:81/356 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CSLLLLLLSQNAAILGQLDSTSSGGSGTGGAP----PDRPPTPPLSLQPSTPSITHFVNESFIIF 68
            |::|...|:...|:|.:      |.||...|.    ||              :||....||.::.
Zfish     3 CAMLRHALALLLALLWK------GPSGAQAAEFGHLPD--------------NITVLEGESVVLR 47

  Fly    69 CQTVQKDIDTKWRDP-----RGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNR 128
            |:..::.....|.:.     .|..:.:...||.:|.......::..|.:.:.|.|.:||.... |
Zfish    48 CKIDEEVTHKAWLNRSNILFTGTDKWSLDSRVSLENNNNSDFSIRIERVMVADEGPYTCSFQA-R 111

  Fly   129 NGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYIN 193
            |..|..:|        .|:|..........|.:||.||.|..:.|...|.|.|.::|        
Zfish   112 NKPRTAHV--------YLIVQVPARIVNISQDKSVNEGEDVNLFCLAVGRPEPTITW-------- 160

  Fly   194 TVNSTKHNRLSNG--LYIRNVSQADAGEYTC-----------RAMRITPTFSDSDQITILLRIQH 245
              ...|:..|:.|  |.|..:.:..|.::.|           |.:::|..:.     .|:..:::
Zfish   161 --KDFKYGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYP-----PIITDVKN 218

  Fly   246 KPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMK 310
            .|            |.||....|.|:||..|..||.|..:::..|..::.:.:.:......|...
Zfish   219 MP------------AQVGKTAILRCEAMAVPTASFEWYRDDRRPVESDNTLKIKNEKTRSLLLFT 271

  Fly   311 NASQ--FGDYKCKVANPLGMLE-RVIKLRPG 338
            |.::  ||:|.|..:|.||... .::..|||
Zfish   272 NVTEKHFGNYTCFASNRLGASNASMLLFRPG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 15/71 (21%)
IG_like 256..336 CDD:214653 21/82 (26%)
IGc2 263..327 CDD:197706 17/65 (26%)
FN3 341..445 CDD:238020
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 22/112 (20%)
Ig 35..123 CDD:299845 20/96 (21%)
Ig 125..>183 CDD:299845 16/67 (24%)
I-set 128..207 CDD:254352 19/88 (22%)
IG_like 217..298 CDD:214653 22/92 (24%)
ig 223..296 CDD:278476 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.