Sequence 1: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138424.1 | Gene: | SDK2 / 54549 | HGNCID: | 19308 | Length: | 2172 | Species: | Homo sapiens |
Alignment Length: | 239 | Identity: | 60/239 - (25%) |
---|---|---|---|
Similarity: | 92/239 - (38%) | Gaps: | 67/239 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 GQLDSTSSGGSG------TGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFCQTVQKDIDTKWR 81
Fly 82 DPRGQTRENTKGRVHIEKKT---TGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLAS 143
Fly 144 FELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRL---SN 205
Fly 206 G-LYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPH 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33543 | NP_001014458.3 | IGc2 | 165..224 | CDD:197706 | 17/62 (27%) |
IG_like | 256..336 | CDD:214653 | |||
IGc2 | 263..327 | CDD:197706 | |||
FN3 | 341..445 | CDD:238020 | |||
SDK2 | NP_001138424.1 | Ig | 27..109 | CDD:299845 | |
IG_like | 40..109 | CDD:214653 | |||
I-set | 120..203 | CDD:254352 | |||
Ig | 132..210 | CDD:299845 | |||
IG_like | 222..304 | CDD:214653 | |||
IGc2 | 233..286 | CDD:197706 | |||
I-set | 308..397 | CDD:254352 | |||
Ig | 326..394 | CDD:143165 | |||
I-set | 402..492 | CDD:254352 | 31/133 (23%) | ||
Ig | 416..492 | CDD:299845 | 26/124 (21%) | ||
Ig | 502..586 | CDD:299845 | 24/88 (27%) | ||
IG_like | 502..586 | CDD:214653 | 24/88 (27%) | ||
FN3 | 590..681 | CDD:238020 | 2/2 (100%) | ||
FN3 | 693..786 | CDD:238020 | |||
FN3 | 794..890 | CDD:238020 | |||
FN3 | 895..983 | CDD:238020 | |||
FN3 | 993..1087 | CDD:238020 | |||
FN3 | 1099..1194 | CDD:238020 | |||
FN3 | 1201..1290 | CDD:238020 | |||
FN3 | 1301..1394 | CDD:238020 | |||
FN3 | 1400..1484 | CDD:238020 | |||
FN3 | 1503..1616 | CDD:238020 | |||
FN3 | 1626..1719 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1707..1729 | ||||
FN3 | 1724..1805 | CDD:238020 | |||
FN3 | 1837..1916 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2039..2067 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2098..2172 | ||||
PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 | 2166..2172 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |