DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Ntm

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001418383.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:286 Identity:62/286 - (21%)
Similarity:116/286 - (40%) Gaps:53/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVNESFIIFCQTVQKDIDTKW-RDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCE 123
            ::|.|.|::..      :.|| .|||.....||:.:..||          .:::.:.|.|.:||.
  Rat    68 WLNRSTILYAG------NDKWCLDPRVVLLSNTQTQYSIE----------IQNVDVYDEGPYTCS 116

  Fly   124 VNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLY- 187
            |..:.:..         .:...|:|.......:.....|:.||.:..:.|...|.|.|.|:|.: 
  Rat   117 VQTDNHPK---------TSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHI 172

  Fly   188 NGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHW--F 250
            :.:.:..|:..::      |.|:.:::..:|||.|.|       |:.....::.|::...::  :
  Rat   173 SPKAVGFVSEDEY------LEIQGITREQSGEYECSA-------SNDVAAPVVRRVKVTVNYPPY 224

  Fly   251 FNET----LPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKN 311
            .:|.    :|     ||....|.|:|...|...|.|..::|.:|.....:.|.:.....:|...|
  Rat   225 ISEAKGTGVP-----VGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKKGVKVENRPFLSRLTFFN 284

  Fly   312 ASQ--FGDYKCKVANPLGMLERVIKL 335
            .|:  :|:|.|..:|.||.....|.|
  Rat   285 VSEHDYGNYTCVASNKLGHTNASIML 310

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 12/52 (23%)
Ig strand E 105..109 CDD:409353 0/3 (0%)
Ig strand F 119..123 CDD:409353 1/3 (33%)
Ig 153..239 CDD:472250 18/86 (21%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 219..224 CDD:409353 3/4 (75%)
Ig strand G 232..235 CDD:409353 1/2 (50%)
IG_like 256..336 CDD:214653 23/82 (28%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 1/3 (33%)
Ig strand E 302..309 CDD:409353 1/6 (17%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020
NtmNP_001418383.1 Ig 44..132 CDD:472250 18/88 (20%)
Ig strand B 53..57 CDD:409382